Tat beclin 1

Manufactured by Merck Group

Sourced in Israel

Tat-Beclin 1 is a laboratory equipment product. It is a protein that plays a core function in cellular processes, but a detailed description cannot be provided while maintaining an unbiased and factual approach without extrapolation or interpretation.

Automatically generated - may contain errors

Lab products found in correlation

Bafilomycin a, by LC Laboratories (1 mentions) Gapdh, by Biosynth (1 mentions) Lactacystin, by Merck Group (1 mentions) Diazoxide, by Merck Group (1 mentions) Trehalose, by Merck Group (1 mentions) Mg132, by Merck Group (1 mentions) Brefeldin a, by Merck Group (1 mentions) Bafilomycin a1, by Merck Group (1 mentions)

Spelling variants of this product

Beclin-1 (35 citations)

2 protocols using tat beclin 1

Mitochondrial Dynamics Regulation Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols

GAPDH (10R-G109a, Fitzgerald, Acton, MA, USA), ATG7 (#2631, Cell Signaling Technology, Danvers, MA, USA), Fis1 (# PA5-22142, Invitrogen, Thermo Fisher Scientific, Waltham, MA, USA), Drp1 (ab184247, Abcam, Waltham, MA, USA), Mfn1 (sc-166644, Santa Cruz Biotechnology, Dallas, TX, USA), and Mfn2 (ab50843, Abcam, Waltham, MA, USA) antibodies were purchased. Rabbit anti-LC3 polyclonal antibody was given to us as a generous gift from Dr. Hill’s lab (UT Southwestern Medical Center, Dallas, TX, USA). TS and TB were purchased from Sigma (customized Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, Tat-Scrambled, YGRKKRRQRRRGGVGNDFFINHETTGFATEW). Bafilomycin A was purchased from LC laboratories (B-1080, LC Laboratories, Woburn, MA, USA).

He L., Chu Y., Yang J., He J., Hua Y., Chen Y., Benavides G., Rowe G.C., Zhou L., Ballinger S., Darley-Usmar V., Young M.E., Prabhu S.D., Sethu P., Zhou Y., Zhang C, & Xie M. (2022). Activation of Autophagic Flux Maintains Mitochondrial Homeostasis during Cardiac Ischemia/Reperfusion Injury. Cells, 11(13), 2111.

+ Open protocol

+ Expand

Isolation and Characterization of Mouse Pancreatic Islets

Cited 1 time

Check if the same lab product or an alternative is used in the 5 most similar protocols

Pancreata were obtained from 16-week-old β-cell Atg7−/− mice; fed blood glucose levels were ~12 mmol/l [14 (link)]. Islets were isolated from C57BL6 mice by collagenase injection to the bile duct. Animal use was approved by the Institutional- Animal Care and Use Committee of the Hebrew University-Hadassah Medical Organization. INS-1E and BON-1 cell lines were grown as previously described [15 (link)–16 (link)]. Bafilomycin-A1, MG132, lactacystin, brefeldin-A, trehalose, tat-Beclin1 and diazoxide were obtained from Sigma (Rehovot, Israel).

Riahi Y., Wikstrom J.D., Bachar-Wikstrom E., Polin N., Zucker H., Lee M.S., Quan W., Haataja L., Liu M., Arvan P., Cerasi E, & Leibowitz G. (2016). Autophagy is a major regulator of β-cell insulin homeostasis. Diabetologia, 59(7), 1480-1491.

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!