GC1 protein was purchased from Enzo life Sciences; GC1 protein was diluted in HEPES 50mM pH 8.0 to lower DTT concentration to 100μM or less. [α-32P]-GTP was from PerkinElmer (Waltham, MA); Western Blot supplies were from Bio-Rad; Bradford Reagent from Bio-Rad; Insect cell medium, SF-900II serum free, was from ThermoFisher; Fetal bovine serum from Sigma; cobalt column from Takeda; Gentamycin from Gibco; anti GC1 α and β from Sigma and Cayman Chemical, respectively; Microcon 10-KDa from Millipore; DEA-NO from Cayman Chemical; TCEP and Dibromobimane from Sigma. Mini-PROTEAN® TGX™ Precast Gels are from Biorad.
Dea no
Manufactured by Cayman Chemical
Sourced in United States
DEA/NO is a laboratory reagent used for the detection and quantification of nitric oxide (NO) and its metabolites. It serves as a specific and sensitive indicator for the presence of nitric oxide in various biological and chemical samples.
Automatically generated - may contain errors
Lab products found in correlation
Gentamycin, by Thermo Fisher Scientific (1 mentions)
Gc1 protein, by Enzo Life Sciences (1 mentions)
Western blot supplies, by Bio-Rad (1 mentions)
α 32p gtp, by PerkinElmer (1 mentions)
Fetal bovine serum (fbs), by Merck Group (1 mentions)
Bradford reagent, by Bio-Rad (1 mentions)
Mini protean tgx precast gel, by Bio-Rad (1 mentions)
Cantharidin, by Bio-Techne (1 mentions)
Heparin, by Merck Group (1 mentions)
Difmup, by Thermo Fisher Scientific (1 mentions)
Fgf18, by Thermo Fisher Scientific (1 mentions)
U46619, by Cayman Chemical (1 mentions)
3 protocols using dea no
1
GC1 Protein Purification and Analysis
2
Synthesis and Validation of BMN-111 Peptide
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
CNP and ANP were obtained from Phoenix Pharmaceutical (catalogs 012-03 and 005-24, respectively). BMN-111 was synthesized by New England Peptide as a custom order with the following sequence: (Cyc[23,39])H2N-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH, as previously described (32 (link)). The purity was > 95%. DEA/NO was from Cayman Chemical (catalog 82100). LB-100 (3-[4-methylpiperazine-1-carbonyl]-7-oxabicyclo[2.2.1]heptane-2-carboxylic acid) was from Selleck Chemicals (catalog S7537) or MedChem Express (catalog HY-18597). Cantharidin was from Tocris (catalog 1548). FGF18 was from PeproTech (catalog 100-28), and heparin was from Sigma-Aldrich (catalog H4784). DiFMUP (6,8-Difluoro-4-methyl-7-[phosphonooxy]-2H-1-benzopyran-2-one) was from Thermo Fisher Scientific (catalog D6567).
3
Pharmacological Reagent Preparation
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
All drugs were purchased from Sigma-Aldrich (St. Louis, MO, USA), except for U46619 and DEA/NO (Cayman Chemical, Ann Arbor, MI, USA), LVK (Tocris Chemicals, Bristol, UK) and GTN (Hospira, Melbourne, VIC, Australia). They were all dissolved in distilled water, with the exception of GTN and U46619, which were dissolved in 100% ethanol (final concentration less than 0.1% ethanol) as 1 mmol/l stock solution and subsequent dilutions were in distilled water. DEA/NO was dissolved in 0.1 M NaOH. Diphenyliodonium and LVK were dissolved in 100% DMSO (final concentration less than 0.1% DMSO).
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!