2 3 dihydroxy 6 nitro 7 sulfamoyl benzo f quinoxaline 2 3 dione nbqx

Manufactured by Bio-Techne

Sourced in United States

2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline-2,3-dione(NBQX) is a selective and potent antagonist of AMPA and kainate receptors. It functions by inhibiting the activity of these glutamate-gated ion channels.

Automatically generated - may contain errors

Lab products found in correlation

D 2 amino 5 phosphonovalerate d ap5, by Bio-Techne (1 mentions) 1 naphthylmethyl 4 amino 1 tert butyl 3 p methylphenyl pyrazolo 3 4 d pyrimidine 1nmpp1, by Santa Cruz Biotechnology (1 mentions) Lidocaine hydrochloride, by Merck Group (1 mentions) Muscimol hydrobromide, by Merck Group (1 mentions) Ro25 6981, by Bio-Techne (1 mentions) Prazosin hydrochloride, by Merck Group (1 mentions) Dl 2 amino 5 phosphonovaleric acid ap5, by Bio-Techne (1 mentions)

4 protocols using 2 3 dihydroxy 6 nitro 7 sulfamoyl benzo f quinoxaline 2 3 dione nbqx

Recombinant BDNF and β-NGF Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols

Human recombinant BDNF and human recombinant β-NGF were
purchased from Millipore, K252a and d-2-amino-5-phosphonovalerate (d-AP5) and
2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline-2,3-dione
(NBQX) were from Tocris, human-IgG was from Sigma, and
1′-naphthylmethyl-4-amino-1-tert-butyl-3-(p-methylphenyl)pyrazolo[3,4-d]
pyrimidine (1NMPP1) was from Santa Cruz and Shanghai Institute of Materia
Medica, Chinese Academy of Sciences. TrkB-Ig was a gift from Regeneron and the
tat-CN21 peptide (YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR) was synthesized by
GenScript.

Harward S.C., Hedrick N.G., Hall C.E., Parra-Bueno P., Milner T.A., Pan E., Laviv T., Hempstead B.L., Yasuda R, & McNamara J.O. (2016). Autocrine BDNF-TrkB signalling within a single dendritic spine. Nature, 538(7623), 99-103.

+ Open protocol

+ Expand

Modulation of Septal-Hippocampal Theta Rhythms

Cited 1 time

Check if the same lab product or an alternative is used in the 5 most similar protocols

The following drugs were administered intracerebrally in the study: (a) muscimol hydrobromide (0.5 μl of 2 μg/μl solution; Sigma, USA), muscimol being a GABA mimetic^{28 (link)}, (b) (2 R)-amino-5-phosphonopentanoate (AP5; 0.5 μl of 5 μg/μl solution; Sigma, USA) which is an antagonist at the glutamate NMDA receptors^{68 (link),89 (link),90 (link)}, (c) 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline-2,3-dione (NBQX; 0.5 μl of 10 μg/μl, 20 μg/μl or 40 μg/μl solution; Tocris, USA) which is an antagonist at glutamate AMPA receptor^{39 (link),92 (link)}, and (d) lidocaine hydrochloride (0.5 μl/site of 4% w/v; Sigma, USA), a local anesthetic^{50 (link)}. The drugs were prepared in 0.5% Alcian blue dye in saline (Sigma, USA) which also acted as vehicle in control experiments. The drugs, (a) through (c), were used in experiments involving microinjection into the MS region. Intraseptal microinjections were made at one given site only, while, in comparison, lidocaine was microinjected bilaterally into the RVM.
Functionally, intraseptal microinjection of the fore-mentioned drugs at the selected concentration attenuates theta rhythmic septo- hippocampal activation^{28 (link),68 (link),89 (link)–91 (link)}. The highest concentration of NBQX used in this study is also known to strongly attenuate afferent stimulation-evoked putative AMPA current in medial septal neurons^{39 (link)}.

Ariffin M.Z., Ibrahim K.M., Lee A.T., Lee R.Z., Poon S.Y., Thong H.K., Liu E.H., Low C.M, & Khanna S. (2018). Forebrain medial septum sustains experimental neuropathic pain. Scientific Reports, 8, 11892.

+ Open protocol

+ Expand

Optogenetic Manipulation and Pharmacological Modulation

Check if the same lab product or an alternative is used in the 5 most similar protocols

Viral vectors (adeno-associated virus [AAV]-channelrhodopsin 2 [ChR2]-tdTomato, AAV-Chronos-green fluorescent protein [GFP], and AAV-Chrimson-tdTomato) were purchased from the University of North Carolina (Vector Core Facility). Ro 25–6981, 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo[f]quinoxaline-2,3-dione (NBQX), and (2R)-amino-5-phosphonovaleric acid; (2R)-amino-5-phosphonopentanoate (APV) were obtained from Tocris. All other reagents were purchased from Sigma.

Ma T., Barbee B., Wang X, & Wang J. (2017). Alcohol induces input-specific aberrant synaptic plasticity in the rat dorsomedial striatum. Neuropharmacology, 123, 46-54.

+ Open protocol

+ Expand

Pharmacological Modulation of Neuronal Activity

Check if the same lab product or an alternative is used in the 5 most similar protocols

For pharmacological experiments, reagents were dissolved in ACSF and applied on the cranial window from 30 min preceding imaging. Tetrodotoxin (TTX, 2 μM, Tocris) was used to block sodium channel. DL-2-amino-5-phosphonovaleric acid (AP-5, 50 μM, Tocris) and 2,3-dihydroxy-6-nitro-7-sulfamoyl-benzo(f)quinoxaline-2,3-dione (NBQX, 20 μM, Tocris) were used to block NMDA-type and AMPA-type ionotropic glutamate receptors, respectively. Prazosin hydrochloride (200 μM, Sigma–Aldrich) was used to block alpha-1 adrenergic receptors (A1ARs).

Ma Z., Du X., Wang F., Ding R., Li Y., Liu A., Wei L., Hou S., Chen F., Hu Q., Guo C., Jiao Q., Liu S., Fang B, & Shen H. (2019). Cortical Plasticity Induced by Anodal Transcranial Pulsed Current Stimulation Investigated by Combining Two-Photon Imaging and Electrophysiological Recording. Frontiers in Cellular Neuroscience, 13, 400.

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!