Log In Sign up
The largest database of trusted experimental protocols

N n bis acryloyl cystamine baca

Manufactured by Merck Group
Visit Supplier

N,N'-bis(acryloyl)cystamine (BACA) is a chemical compound used in laboratory settings. It is a bifunctional monomer with two acryloyl groups and a central cystamine moiety. BACA is utilized in the synthesis and modification of polymeric materials, but its core function is not further extrapolated on.

Automatically generated - may contain errors

Lab products found in correlation

Ammonium persulfate, by Thermo Fisher Scientific (3 mentions) Acrylic acid, by Thermo Fisher Scientific (3 mentions) N 3 aminopropyl methacrylamide hydrochloride apma, by Merck Group (3 mentions) Bis acrylamide, by Thermo Fisher Scientific (2 mentions) Acrylate peg, by Thermo Fisher Scientific (2 mentions) 1 vinylimidazole, by Thermo Fisher Scientific (2 mentions) Acrylate peg nh2, by JenKem Technology (2 mentions) 4 imidazolecarboxylic acid, by Merck Group (2 mentions) Acrylate peg mal apeg mal, by Creative PEGWorks (2 mentions) Tris 2 carboxyethyl phosphine tcep, by Thermo Fisher Scientific (1 mentions) N n n n tetramethylethylenediamine, by Thermo Fisher Scientific (1 mentions) In vitro transcribed single guide rnas sgrnas, by Integrated DNA Technologies (1 mentions) Ammonium hydroxide, by Thermo Fisher Scientific (1 mentions) Ammonium peroxodisulfate, by Tokyo Chemical Industry (1 mentions) Silver nitrate, by Merck Group (1 mentions) Tetraethyl orthosilicate, by Merck Group (1 mentions) Tannic acid, by Merck Group (1 mentions) Sodium citrate dehydrate, by Merck Group (1 mentions)

Close spelling variants of this product

Cystamine (29 citations) N,N′-bis(acryloyl)cystamine (6 citations)

4 protocols using n n bis acryloyl cystamine baca

1

Modular Polymer Functionalization Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
Acrylic acid (AA), N,N,N’,N’-tetramethylethylenediamine (TMEDA), acrylate PEG (APEG; 480 Da), bisacrylamide (BAA), 1-vinylimidazole (VI), and ammonium persulfate (APS) were purchased from ThermoFisher Scientific (Fitchburg, WI, USA). acrylate PEG-NH2 (APEG-NH2; 2 kDa) was acquired from JenKem Technology (Allen, TX, USA). 4-Imidazolecarboxylic acid, all-trans-retinoic acid (ATRA), N-(3-aminopropyl)methacrylamide hydrochloride (APMA), and N,N’-bis(acryloyl)cystamine (BACA) were obtained from Sigma-Aldrich (St. Louis, MO). acrylate PEG-Mal (APEG-Mal; 2 kDa) was purchased from Creative PEGWorks (Chapel Hill, NC). Cell penetrating peptide (CPP), TAT-Cys (CYGRKKRRQRRR), was synthesized by Genscript (Piscataway, NJ).
Chen G., Abdeen A.A., Wang Y., Shahi P.K., Robertson S., Xie R., Suzuki M., Pattnaik B.R., Saha K, & Gong S. (2019). A biodegradable nanocapsule delivers a Cas9 ribonucleoprotein complex for in vivo genome editing. Nature nanotechnology, 14(10), 974-980.
+ Open protocol
+ Expand
2

Engineered Biomaterials for CRISPR Delivery

Check if the same lab product or an alternative is used in the 5 most similar protocols
Acrylic acid (AA), N,N,N′,N′-tetramethylethylenediamine (TEMED), 1-vinylimidazole (VI) and ammonium persulfate (APS), and tris(2-carboxyethyl)phosphine (TCEP)were purchased from Thermo Fisher Scientific. Acrylate-mPEG (Ac-mPEG, 2 kDa) and acrylate-PEG-maleimide (Ac-PEG-Mal, 2 kDa) were acquired from Biochempeg Scientific Inc. N-(3-aminopropyl)methacrylamide hydrochloride (APMA) and N,N′-bis(acryloyl)cystamine (BACA) were purchased from Sigma-Aldrich. Peptides, Cys-TAT (CYGRKKRRQRRR) and RVG-Cys (YTIWMPENPRPGTPCDIFTNSRGKRASNGC) were synthesized by Genscript. Nuclear localization signal (NLS)-tagged Streptococcus pyogenes Cas9 nuclease (sNLS-SpCas9-sNLS) was obtained from Aldevron. In vitro transcribed single guide RNAs (sgRNAs) were purchased from Integrated DNA Technologies, Inc., or Synthego. The sgRNAs used in this experiment include the Ai14 sgRNA (protospacer 5′ - AAGTAAAACCTCTACAAATG-3′) and a non-targeting sgRNA (Alt-R CRISPR-Cas9 Negative Control crRNA #1, Integrated DNA Technologies, Inc., USA). GFP-targeting sgRNAs (GFP protospacer: 5’-GCACGGGCAGCTTGCCGG-3’) were purchased from Synthego (i.e., sgRNA 1) and Integrated DNA Technologies (i.e., sgRNA 2).
Metzger J.M., Wang Y., Neuman S.S., Snow K.J., Murray S.A., Lutz C.M., Bondarenko V., Felton J., Gimse K., Xie R., Li D., Zhao Y., Flowers M.T., Simmons H.A., Roy S., Saha K., Levine J.E., Emborg M.E, & Gong S. (2022). Efficient in vivo neuronal genome editing in the mouse brain using nanocapsules containing CRISPR-Cas9 ribonucleoproteins. Biomaterials, 293, 121959.
+ Open protocol
+ Expand
3

Modular Polymer Functionalization Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
Acrylic acid (AA), N,N,N’,N’-tetramethylethylenediamine (TMEDA), acrylate PEG (APEG; 480 Da), bisacrylamide (BAA), 1-vinylimidazole (VI), and ammonium persulfate (APS) were purchased from ThermoFisher Scientific (Fitchburg, WI, USA). acrylate PEG-NH2 (APEG-NH2; 2 kDa) was acquired from JenKem Technology (Allen, TX, USA). 4-Imidazolecarboxylic acid, all-trans-retinoic acid (ATRA), N-(3-aminopropyl)methacrylamide hydrochloride (APMA), and N,N’-bis(acryloyl)cystamine (BACA) were obtained from Sigma-Aldrich (St. Louis, MO). acrylate PEG-Mal (APEG-Mal; 2 kDa) was purchased from Creative PEGWorks (Chapel Hill, NC). Cell penetrating peptide (CPP), TAT-Cys (CYGRKKRRQRRR), was synthesized by Genscript (Piscataway, NJ).
Chen G., Abdeen A.A., Wang Y., Shahi P.K., Robertson S., Xie R., Suzuki M., Pattnaik B.R., Saha K, & Gong S. (2019). A biodegradable nanocapsule delivers a Cas9 ribonucleoprotein complex for in vivo genome editing. Nature nanotechnology, 14(10), 974-980.
+ Open protocol
+ Expand
4

Synthesis of Metallic Nanoparticles

Check if the same lab product or an alternative is used in the 5 most similar protocols
Iron(III) chloride hexahydrate (FeCl3·6H2O, >97%), iron(II) chloride (FeCl2, 98%), Co(NO3)2·6H2O, sodium citrate dehydrate (Na3-citrate, ≥99%), gold(III) chloride trihydrate (HAuCl4·3H2O, ≥99.9%), silver nitrate (AgNO3, ≥99.0%), tannic acid (American Chemical Society reagent), hexane (95%), iodine (I2, >98.0%), potassium iodide (KI, ≥99.5%), pNIPAM carboxylic acid terminated (pNIPAM-COOH, Mn ~ 2000), pNIPAM-amine terminated (pNIPAM-NH2, Mn ~ 5500), trichloro(1H,1H,2H,2H-perfluorooctyl)silane (PFOTCS), tetraethyl orthosilicate (TEOS, 98%), polystyrene-block-poly(ethylene-ran-butylene)-block-polystyrene-graft-maleic anhydride (maleic copolymer), and N,N-bis(acryloyl)cystamine (BACA) were purchased from Sigma-Aldrich. Acrylamide monomer (AM, >98.0%), ammonium peroxodisulfate (APS, >99.0%), and 2-methylimidazole (2-MIM) were purchased from Tokyo Chemical Industry. Ammonium hydroxide (28 to 30%) was purchased from Acros Organics. All chemicals were used without further purification.
Li T., Chan K.H., Ding T., Wang X.Q., Cheng Y., Zhang C., Lu W., Yilmaz G., Qiu C.W, & Ho G.W. (2021). Dynamic thermal trapping enables cross-species smart nanoparticle swarms. Science Advances, 7(2), eabe3184.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!