The largest database of trusted experimental protocols

N dodecyl β d maltopyranoside ddm

Manufactured by Merck Group
Sourced in Germany

N-dodecyl-β-D-maltopyranoside (DDM) is a non-ionic detergent used in biochemical and biophysical applications. It is a maltose-based detergent that can solubilize and stabilize membrane proteins. DDM is widely used in the purification and characterization of membrane proteins.

Automatically generated - may contain errors

4 protocols using n dodecyl β d maltopyranoside ddm

1

Protein Interaction Analysis via Co-Immunoprecipitation

Check if the same lab product or an alternative is used in the 5 most similar protocols
Antibodies used are listed in Table S8. Yeast cell lysates were prepared as described previously (Fei et al., 2008 (link)). 2 mg protein was used for each co-immunoprecipitation condition. Antibody was immobilized on magnetic Dynabeads (Dynabeads Co-Immunoprecipitation Kit manual). After 30 min of incubation with the cell lysates containing overexpressed protein at RT, or after overnight incubation with the cell lysates containing low levels of recombinant protein at 4°C, beads were washed and eluted at 37°C for 20 min. Proteins were transferred onto polyvinylidene fluoride (PVDF) membranes, followed by immunodetection (Fei et al., 2008 (link)).
Transiently or stably transfected mammalian cells (MEFs, mouse 3T3-L1preadipocytes, and HeLa cells) were washed three times with ice-cold PBS and lysed in immunoprecipitation (IP) lysis/wash buffer (as above) containing 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM; Sigma) by forcing the cells 30 times through a 0.8-mm needle. Immunoprecipitation and western blotting were carried out as described above.
+ Open protocol
+ Expand
2

Labeling and Characterization of GpA Transmembrane Peptides

Check if the same lab product or an alternative is used in the 5 most similar protocols
Peptides corresponding to residues 69–101 of the human GpA TM domain (SEPEITLIIFGVMAGVIGTILLISYGIRRLIKK) were custom-synthesized and labeled at the N-terminus with either the donor or the acceptor dyes fluorescein (FL) and 5-6-carboxyrhodamine (TAMRA), respectively (Peptide Specialty Laboratories, Heidelberg, Germany). The purity of the labelled peptides was confirmed by high-performance liquid chromatography (HPLC) and mass spectrometry [24] (link). Based on this, the labeled peptides used in this study were>95% pure. Peptides were dissolved in 2,2,2-trifluoroethanol purchased from Sigma-Aldrich (Munich, Germany). APol A8-35 was purchased from Affymetrix (Santa Clara, USA) and sodium dodecyl sulfate (SDS) from Roth (Karlsruhe, Germany). N-dodecyl-β-D-maltopyranoside (DDM) was obtained from Sigma-Aldrich (Munich, Germany).
+ Open protocol
+ Expand
3

Protein Interaction Analysis via Co-Immunoprecipitation

Check if the same lab product or an alternative is used in the 5 most similar protocols
Antibodies used are listed in Table S8. Yeast cell lysates were prepared as described previously (Fei et al., 2008 (link)). 2 mg protein was used for each co-immunoprecipitation condition. Antibody was immobilized on magnetic Dynabeads (Dynabeads Co-Immunoprecipitation Kit manual). After 30 min of incubation with the cell lysates containing overexpressed protein at RT, or after overnight incubation with the cell lysates containing low levels of recombinant protein at 4°C, beads were washed and eluted at 37°C for 20 min. Proteins were transferred onto polyvinylidene fluoride (PVDF) membranes, followed by immunodetection (Fei et al., 2008 (link)).
Transiently or stably transfected mammalian cells (MEFs, mouse 3T3-L1preadipocytes, and HeLa cells) were washed three times with ice-cold PBS and lysed in immunoprecipitation (IP) lysis/wash buffer (as above) containing 1% (w/v) n-dodecyl-β-D-maltopyranoside (DDM; Sigma) by forcing the cells 30 times through a 0.8-mm needle. Immunoprecipitation and western blotting were carried out as described above.
+ Open protocol
+ Expand
4

Detergent Screening for Protein Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
The following detergents were used: 1-palmitoyl-2-hydroxy-sn-glycero-3-phospho-(1’-rac-glycerol) (LPPG; Avanti Polar Lipids, Inc.); octyl β-D-glucopyranoside (OG; Sigma-Aldrich); n-dodecylphosphocholine (DPC; Affymetrix); empigen (Sigma-Aldrich); n-dodecyl β-D-maltopyranoside (DDM; Sigma-Aldrich); 1-myristoyl-2-hydroxy-sn-glycero-3-phospho-(1’-rac-glycerol) (LMPG; Affymetrix); 1-oleoyl-2-hydroxy-sn-glycero-3-phospho-(1’-rac-glycerol) (LOPG; Avanti Polar Lipids, Inc.). His60 Ni Superflow resin was purchased from Clontech. Protease inhibitor cocktail was purchased from Fermentas and RNAse was from Thermo Scientific. DNAse, glutaraldehyde, and 1-anilinonaphthalene-8-sulfonic acid (ANS) were purchased from Sigma-Aldrich. All other reagents were of analytical grade.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!