The largest database of trusted experimental protocols

19 protocols using paxilline

1

BK Channel Modulation Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
(1,3-dihydro-1-[2-hydroxy-5-(trifluoromethyl)-phenyl]-5-(trifluoromethyl)-2H-benzimidazol-2-one), NS1619 (Tocris), a specific BKCa channel opener; Paxilline (alomone), a BKCa channel blocker; NS1619 and Paxilline were both dissolved in dimethysulfoxide (DMSO), and then diluted in ACSF to the final concentration of 10 μM.
+ Open protocol
+ Expand
2

Reconstitution and Application of Peptides

Check if the same lab product or an alternative is used in the 5 most similar protocols
Paxilline and tetrodotoxin (Tocris, Bristol, UK) were prepared as 1,000 × stocks in DMSO and water, respectively. β2N, was synthesized as the first 45 amino acids of the β2 subunit (MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALKAGED) (GenScript, Piscatawa, NJ, USA)41 (link). β2NΔFIW was a 42 amino acid peptide with the underlined FIW deletion. Lyophilized peptides were reconstituted in intracellular solution as 100 × stocks and added at the final indicated concentrations.
+ Open protocol
+ Expand
3

Pharmacological Modulation of Ion Channels

Check if the same lab product or an alternative is used in the 5 most similar protocols
Drugs were applied to the perfusion bath or through puff apparatus, as previously described [15 (link)]. Verapamil (20 µM), nickel (100 µM or 200 µM), TEA (2 mM), muscimol (10 µM), bicuculline methiodide (BMI, 10 µM), glutamate (100 µM), NMDA (300 µM), AP5 (50 µM), CNQX (10 µM) were purchased from Sigma, Italy. Paxilline (10 µM) was purchased from Tocris Bioscience UK, and TTX (500 nM) from Alomone Labs, Israel.
+ Open protocol
+ Expand
4

Biochemical Reagents for Cell Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols
NS309 and paxilline were purchased from Tocris Bioscience (USA); All other chemicals and reagents were obtained from Sigma-Aldrich (USA). The vehicle for HB-EGF solutions was 0.2-μm–filtered PBS containing 0.1% BSA.
+ Open protocol
+ Expand
5

Physiological Saline Solution for Mesenteric Artery Myography

Check if the same lab product or an alternative is used in the 5 most similar protocols
Physiological saline solution (PSS) for surgical isolation of mesenteric arteries and myography experiments containing 6 mM KCl, 112 mM NaCl, 1.18 mM NaHCO3, 1.18 mM MgSO4, 1.18 mM KH2PO4, 1.18 mM CaCl2, and 10 mM glucose was gassed with 21% O2/5% CO2 to pH the solution to approximately 7.4. 60 mM K+-PSS (60K) that was used to test the viability of isolated vessel segments was prepared by equimolar replacement of NaCl with KCl. Dapagliflozin was purchased from Ambeed Inc. (Arlington Heights, IL, USA). Phenylephrine (PE), and 4-aminopyridine (4-AP) and XE 991 were purchased from Sigma-Aldrich (St. Louis, MO, USA). Indomethacin, DPO-1, Linopirdine, Psora-4, Glibenclamide, paxilline, ODQ, KT5823, L-NNA, SNP and acetylcholine (ACh) were purchased from Tocris (Minneapolis, MN, USA). Drug/modulator stocks were prepared by dissolving them in suitable solvents: 4-AP, SNP and PE in distilled water; dapagliflozin, DPO-1, Linopirdine, Psora-4, Indomethacin, Glibenclamide, paxilline, ODQ, KT5823, L-NNA, and ACh in dimethyl sulfoxide (DMSO, final concentration <0.1%). Anti-SGLT2 antibody was purchased from Abcam (Cambridge, UK), and anti-rabbit horseradish peroxidase-conjugated secondary antibody from Santa Cruz Biotechnology (Dallas, TX, USA).
+ Open protocol
+ Expand
6

Immunofluorescence Staining Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
All primary antibodies used in the present study are listed in Table S7. All secondary antibodies were isotype-specific and conjugated to Alexa Fluor 488- or Alexa Fluor 555 (Thermo Fisher Scientific). dl-2-Amino-5-phosphonopentanoic acid sodium salt (AP-5, #105), Forskolin (#1099), and Paxilline (#2006) were from Tocris. Nifedipine (#N7634), Picrotoxin (#P1675) and Rolipram (#R6520) were from Sigma-Aldrich. DNA oligonucleotide primers used in this study are listed in Table S6. If not specifically stated, all other reagents were of standard quality and from the usual vendors.
+ Open protocol
+ Expand
7

Experimental Protocols for Potassium Channel Modulators

Check if the same lab product or an alternative is used in the 5 most similar protocols
TRAM-34 and SKA-31 were kind gifts from Dr. Heike Wulff, Department of Pharmacology, University of California Davis, California, USA. Paxilline was purchased from Tocris Bioscience (Bristol, United Kingdom). TRIZOL reagent was purchased from Invitrogen (United Kingdom). The RNase-Free DNase Set (Qiagen, Germany) was used for DNase digestion. Complementary DNA (cDNA) was synthesized using iScript cDNA Synthesis Kit (Bio-Rad, CA, USA). The new negative-gating modulator of KCa3.1, RA-2 (1,3-phenylenebis(methylene) bis(3-fluoro-4-hydroxybenzoate), was synthesized in house [61 ]
+ Open protocol
+ Expand
8

Thalidomide and Paxilline Behavioral Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols
Thalidomide (Tocris Bioscience, Minneapolis, MN, USA) was dissolved to 25 mM in dimethylsulfoxide (DMSO) and then diluted 1:10 in saline for injection. Paxilline (Tocris Bioscience) was dissolved to 10 mM in DMSO and then diluted 1:2,000 in saline for injection. Thalidomide (30 mg/kg) or vehicle (10% (v/v) DMSO) was injected intraperitoneally of 24 h before open field test, tail suspension test, forced swimming test, elevated plus maze test, or the three-chamber social interaction tests. In the passive avoidance test and novel object recognition tests, the same dose of Thalidomide was injected two times before the tests. Paxilline (3 μg/kg) or vehicle (0.05% (v/v) DMSO) was injected intraperitoneally 3 h before the tests.
+ Open protocol
+ Expand
9

Perforated Patch-Clamp and Ca2+ Imaging Experiments

Check if the same lab product or an alternative is used in the 5 most similar protocols
The Ca2+-free dissection solution, the extracellular bath solution used in the perforated patch-clamp and Ca2+ imaging experiments, and the patch-clamp pipette solution for perforated whole cell patch-clamp experiments were prepared as described previously (Hristov et al., 2013 ; Smith et al., 2013 (link)). Freshly-dissolved amphotericin-B (200 g/ml) in dimethyl sulfoxide (DMSO) was added to the pipette solution before the experiments and replaced every 1-2 h. PGE2 and fura 2-AM were purchased from Sigma-Aldrich (St. Louis, MO) and were dissolved in ethanol and DMSO as stock solutions, respectively. Paxilline was purchased from Tocris Bioscience (Bristol, UK) and was dissolved in DMSO. The DMSO concentration in the bath solution did not exceed 0.1%.
+ Open protocol
+ Expand
10

Selective Potassium Channel Blockade in Myoblasts

Check if the same lab product or an alternative is used in the 5 most similar protocols
The small molecule paxilline (Tocris, Ellisville, MI, USA) and the peptide iberiotoxin (CS Bio, Menlo Park, CA, USA) were used as a selective blocker of KCa1.1.60 (link) Tetraethylammonium (TEA) chloride (Sigma) was used as a nonselective blocker of potassium channels. The α-subunits of KCa1.1 were transduced into myoblasts using the Bacmam expression system as described;42 (link), 61 BacMam vectors expressing GFP were used as controls. Myoblasts were transduced at a multiplicity of infection of 100.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!