Log In Sign up
The largest database of trusted experimental protocols

Rab5 c8b1 rabbit mab

Manufactured by Cell Signaling Technology
Visit Supplier

Rab5 (C8B1) rabbit mAb is a monoclonal antibody that recognizes the Rab5 protein, which is a small GTPase involved in early endosome formation and trafficking. This antibody can be used for the detection and analysis of Rab5 in various applications, such as Western blotting, immunoprecipitation, and immunocytochemistry.

Automatically generated - may contain errors

Lab products found in correlation

Eea1 c45b10 rabbit mab, by Cell Signaling Technology (2 mentions) Ly6c pe, by Thermo Fisher Scientific (1 mentions) Phospho nf κb p65 ser536 93h1 rabbit mab, by Cell Signaling Technology (1 mentions) Fluorescein isothiocyanate isomer 1 fitc, by Merck Group (1 mentions) Alexa fluor 488 dye, by Thermo Fisher Scientific (1 mentions) F4 80 apc, by Thermo Fisher Scientific (1 mentions) Cd4 fitc, by Thermo Fisher Scientific (1 mentions) Cd11b apc, by Thermo Fisher Scientific (1 mentions) Cd8 pe, by Thermo Fisher Scientific (1 mentions) Cd11b pe, by Thermo Fisher Scientific (1 mentions) Cell counting kit 8 cck 8, by Merck Group (1 mentions) B220 apc, by Thermo Fisher Scientific (1 mentions) Gr 1 fitc, by Thermo Fisher Scientific (1 mentions) Alexa fluor 647 dye, by Thermo Fisher Scientific (1 mentions) β actin mouse mab, by Santa Cruz Biotechnology (1 mentions) Polyinosinic polycytidylic acid poly 1 c, by Merck Group (1 mentions) Rab7 d95f2, by Cell Signaling Technology (1 mentions) Chlorpromazine, by Merck Group (1 mentions) Nystatin, by Merck Group (1 mentions) Dynasore, by Enzo Life Sciences (1 mentions)

Spelling variants of this product

Rab5 (C8B1), (3 citations) Rabbit mABs (2 citations)

2 protocols using rab5 c8b1 rabbit mab

1

Immune Signaling Pathway Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Lipopolysaccharide (LPS, Escherichia coli 0111:B4), lipoteichoic acid (LTA), and polyinosinic:polycytidylic acid (Poly I:C) were from Sigma-Aldrich, and phosphorothioate-modified CpG ODN was synthesized by Sybersyn. Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (197G2) rabbit mAb, Phospho-SAPK/JNK (Thr183/Tyr185) (81e11) rabbit mAb, Phospho-p38 MAPK (Thr180/Tyr182) (D3F9) rabbit mAb, Phospho-NF-κB p65 (Ser536) (93H1) rabbit mAb, EEA1 (C45B10) rabbit mAb, Rab5 (C8B1) rabbit mAb, and Rab7 (D95F2) rabbit mAb were from Cell Signaling Technology. CD107a/LAMP-1 mouse mAb was from BioLegend; β-actin mouse mAb and Ccz1 antibodies (L-20) were obtained from Santa Cruz Biotechnology; SNX10 antibody (HPA015605) was acquired from Sigma-Aldrich. Mouse CD4-FITC, CD8-PE, B220-APC, CD11b-PE, CD11b-APC, Gr1-FITC, Ly6C-PE, and F4/80-APC antibodies were purchased from eBioscience. Fluorescein isothiocyanate isomer I (FITC) and Cell Counting Kit-8 (CCK-8) were from Sigma-Aldrich; Alexa Fluor® 488 dye and Alexa Fluor® 647 dyes were from Thermo Fisher Scientific.
Lou J., Li X., Huang W., Liang J., Zheng M., Xu T., Lyu J., Li D., Xu Q., Jin X., Fu G., Wang D, & Lu L. (2017). SNX10 promotes phagosome maturation in macrophages and protects mice against Listeria monocytogenes infection. Oncotarget, 8(33), 53935-53947.
+ Open protocol
+ Expand
2

Nanoparticle Uptake Mechanisms and Intracellular Localization

Check if the same lab product or an alternative is used in the 5 most similar protocols
Poly(lactic co-glycolic acid) with a carboxyl terminus (PLGA, 50:50 monomer ratio and 0.55-0.75 dL/g inherent viscosity) was purchased from LACTEL®. The lipid, 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[carboxy(polyethylene glycol)-2000] (DSPE-PEG), used for one of the surface modifications was purchased from Avanti Polar Lipids. The following peptides were synthesized with an N-terminus cysteine or biotin, followed by a serine-glycine spacer, and were RP-HPLC purified by the W.M. Keck Peptide Synthesis Facility at Yale University (New Haven, CT):
Penetratin (AP): SG-RQIKIWFQNRRMKWKK
End binding protein 1 (EB1): SG-LIRLWSHLIHIWFQNRRLKWKKK
MPG: SG-GALFLGFLGAAGSTMGAWSQPKKKRKV
MPGΔNLS: SG-GALFLGFLGAAGSTMGAWSQPKSKRKV
For uptake inhibition studies, the following chemicals were purchased: Dynasore (Enzo Life Sciences), Chlorpromazine (Sigma), Nystatin (Sigma) and LY294002 (Cell Signaling Technology). To determine intracellular localization, the following primary antibodies were ordered from Cell Signaling Technology and used to stain intracellular proteins: EEA1 (C45B10) rabbit mAb, Rab5 (C8B1) rabbit mAb, Rab7 (D95F2) XP™, clathrin heavy chain (CHC) (D3C6) XP® rabbit mAb, and Rab11 (D4F5) XP® rabbit mAb. LAMP-1, a mouse mAb, was ordered from Santa Cruz Biotechnology. Donkey anti-mouse and anti-rabbit rhodamine-conjugated secondary antibodies were purchased from Invitrogen.
Steinbach J.M., Seo Y.E, & Saltzman W.M. (2015). Cell Penetrating Peptide-Modified Poly(Lactic-co-Glycolic Acid) Nanoparticles with Enhanced Cell Internalization. Acta biomaterialia, 30, 49-61.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!