The largest database of trusted experimental protocols

Envison hrp

Manufactured by Agilent Technologies
Sourced in Japan

The Envision™ + HRP is a laboratory equipment product manufactured by Agilent Technologies. It is a detection system used for immunohistochemistry applications. The core function of this product is to provide a sensitive and reliable method for visualizing target antigens in tissue samples.

Automatically generated - may contain errors

2 protocols using envison hrp

1

Immunohistochemical Profiling of Tumor Samples

Check if the same lab product or an alternative is used in the 5 most similar protocols
Antigen retrieval was performed on freshly cut sections in a decloaking chamber for 5 min at 125°C in TRIS buffer (pH 9.0). Endogenous peroxidase was blocked by incubation with 3% peroxide at room temperature for 2 min. For IL-1α staining, human specific IL-1α antibody (ab9614, Abcam) was applied at 1:250 in Dako diluent for 2 h at room temperature. The peptide sequence used to raise this antibody is SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA (amino acids 113-271) and therefore recognizes both full length/pro-IL-1α (amino acids 1-271) and mature IL-1α (amino acids 113-271). EGFR immunostaining was performed with antibody (H11, Dako) at 1:200 dilution. Bound antibody was detected using Envison™ + HRP, rabbit (Dako North America) for 30 min at room temperature followed by incubation with diaminobenzidine substrate (DAB) for 5 min at room temperature. HPV status was determined by p16 expression [19 (link), 20 (link)]. After completion of IHC, slides were stored at room temperature and a virtual scanned copy of the TMA slides was kept for further reference.
+ Open protocol
+ Expand
2

Immunohistochemical Detection of LF

Check if the same lab product or an alternative is used in the 5 most similar protocols
Tissue specimens were surgically obtained and fixed in 10% formalin for 24 h at room temperature, followed by paraffin embedment at 56°C. From each tissue block, 4-μm thick sections were cut, mounted on MAS-coated slide glasses (Matsunami Glass Ind., Tokyo, Japan), and de-paraffinized in xylen. The sections were rehydrated in graded ethanol solutions. For antigen retrieval of tissue sections, the slides were incubated with Proteinase K (DAKO) for 5 min at room temperature in a moist chamber. Endogenous peroxidase was blocked with 3% hydrogen peroxide (H 2 O 2 ) for 10 min at room temperature and the slides were washed thrice with PBS. The sections were blocked with 5% BSA in PBS and incubated with primary antibody (rabbit polyclonal anti-human LF; Abcam, UK) at 4°C overnight. The slides were washed thrice with PBS and probed with a secondary antibody (EnVison/HRP; DAKO, Japan) according to the instructions supplied by the manufacturers. Visualization was performed with 3′, 3′-diaminobenzidine substrate solution. The slides were counterstained with hematoxylin 3G (Sakura-finetek, Tokyo) for 45 s at room temperature. LF immunoreactivity was classified into 2 categories: positive, ≥ 10% of tumor cells were immunostained; negative, < 10% of tumor cells were immunostained.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!