The largest database of trusted experimental protocols

2 protocols using tau r3

1

Tau Aggregation and Cellular Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols
Tau-R3 (306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ) and Tau-R3-FITC were synthesized at China Peptides Co., Ltd. (Shanghai, China). Thioflavin T (ThT) was purchased from Sigma. Heparin (average molecular mass of 12 kDa) was obtained from Aladdin. All of the metal cations used were chloride forms of analytical grade, which were all purchased from Macklin, and Tris-base was purchased from VOVON. Cell culture media was purchased from HyClone and Gibco. The Cell-Counting Kit-8 Assay, Oxygen Species Assay Kit, Hoechst 33342, Dil-Tracker Red, ER-Tracker Red, and Golgi-Tracker Red were all obtained from Beyotime Biotechnology (Beyotime, Nanjing, China). All of the other chemicals that were used were of analytical grade.
+ Open protocol
+ Expand
2

Genipin-Mediated Tau Aggregation Inhibition

Check if the same lab product or an alternative is used in the 5 most similar protocols
Genipin was purchased from MedChemExpress (Monmouth Junction, New Jersey, USA). Tau-R3 was obtained from ChinaPeptides (Shanghai, China). Heparin sodium salt was obtained from Aladdin (Shanghai, China). Thio avin T (ThT) was obtained from Sigma-Aldrich (St. Louis, MO, USA). Dulbecco's modi ed Eagle medium (DMEM), F12-DMEM, opti-MEM, neurobasal medium, B27 supplement, streptomycin, penicillin, L-glutamine and phosphate buffer solution (PBS) were purchased from Gibco (Grand Island, NY, USA). Fetal bovine serum (FBS) was supplied from Biological Industries (Kibbutz Beit Haemek, Israel). The cell counting kit (CCK)-8 and bicinchoninic acid (BCA) protein assay kit were provided by Beyotime (Jiangsu, China). Protease and phosphatase inhibitors were obtained from Bimake (Shanghai, China). The following antibodies were used in this study: anti-Tau, anti-phospho-T231, antiphospho-S396, anti-phospho-S404, anti-CDK5, anti-phospho-GSK-3β (Tyr 216 ), anti-LC3, anti-amyloid precursor protein (APP), anti-Aβ, anti-BACE1, and anti-β-actin (Abcam, Cambridge, UK); anti-p62, anti-Beclin-1, anti-SIRT1, anti-LKB1, anti-phospho-LKB1, anti-AMPK, anti-phospho-AMPK, anti-mTOR, antiphospho-mTOR, anti-p70S6K, anti-phospho-p70S6K, anti-PERK, anti-phospho-PERK, anti-eIF2a, and antiphospho-eIF2a (Cell Signaling Technology, Beverly, MA, USA).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!