Gadolinium chloride hexahydrate

Oleic acid (OA, >90%), 1-octadecene (ODE, >90%), Arg-Gly-Asp (RGD, 97%), polyacrylamide (PAM, M_n = 40 000), (3-aminopropyl)triethoxysilane (APTS, 99%), sodium hydroxide (NaOH, 97%), and hydrochloric acid (HCl, 37%) were purchased from Sigma-Aldrich. Cyclohexane (99.5%), N-hexane (97%), ethanol (99.7%), and diethylene glycol (DEG, 98%) were purchased from General-Reagent. Sodium oleate (NaOL, 98%), gadolinium chloride hexahydrate (GdCl₃·6H₂O, 99.99%), and citric acid (CA, 99.5%) were purchased from Macklin. N,N-Dimethylformamide (DMF, 99.8%) and oleylamine (OM, 80–90%) were purchased from Aladdin. Poly(acrylic acid) (PAA5000, M_w = 5000, 50 wt%) and Poly(acrylic acid) (PAA2000, M_w = 2000, 63 wt%) were purchased from Acros Organics.

Poly(l‐lactide)‐poly(ethylene glycol)‐maleimide (PLA‐PEG‐Mal, MW of PLA is 10 k and MW of PEG is 5k, >90%) and poly(l‐lactide)‐poly(ethylene glycol)‐amine (PLA‐PEG‐NH₂, MW of PLA is 10k and MW of PEG is 5k, >90%) were purchased from Xi'an Ruixi Biotechnology Co., Ltd. Rifampicin (98%), triethylamine, dimethyl sulfoxide, dioxane, and gadolinium chloride hexahydrate (98%) were purchased from Shanghai Macklin Biochemical Technology Co., Ltd. Diethylenetriaminepentaacetic acid (DTPA, 98%) was bought from Aladdin. RVG29 (YTIWMPENPRPGTPCDIFTNSRGKRASNGC) was purchased from Shanghai Apeptide Co., Ltd. Tetrahydrofurfuryl chloride was bought from Tianjin Damao Chemical Reagent Factory. Other chemicals were analytical‐grade level, and all the aqueous solutions were prepared by using DI water. The Aβ antibody (1–42 specific), PSD95 antibody, SYP antibody, and beta‐Tubulin antibody were purchased from Cell Signaling Technology. The horseradish peroxidase‐conjugated secondary antibody was purchased from Beijing Dinguo Changsheng Biotechnology Co., Ltd. The TRITC donkey anti‐rabbit secondary antibody was purchased from Life Technologies (Thermo Fisher Scientific).