The largest database of trusted experimental protocols

Siinfekl

Manufactured by Biosynth

SIINFEKL is a synthetic peptide that can be used in various research applications. It serves as a model antigen derived from the chicken ovalbumin protein.

Automatically generated - may contain errors

3 protocols using siinfekl

1

Antigen-specific CD8+ T cell suppression

Check if the same lab product or an alternative is used in the 5 most similar protocols
Purified CD8+ T cells were labelled with 1 µM CFSE (Invitrogen) at 37°C for 20 min in serum-free RPMI. OT1 CFSE-labelled splenocytes were stimulated with OVA (SIINFEKL) peptide for 5 days in the presence or absence of recombinant human βig-h3 (rβig-h3) at a final concentration of 5 µg/mL. The antigen-specific suppression of CD8+ T cells was evaluated in coculture assays in which splenocytes obtained from OT-1 transgenic mice (antigen-specific assays) were seeded in triplicate in 96-well round bottom plates (5×105 cells/well). The splenocytes were cultured in the presence of CAF SN that was treated with or without anti-βig-h3 Ab and then stimulated with a cognate antigen, the OVA-derived peptide SIINFEKL (1 mg/mL; New England Peptide) for 3 days. Alternatively, mitomycin-treated KC cells were cocultured with CFSE-labelled pancreatic lymph node cells in the presence of a depleting anti-βigh3 Ab or control Ab (BioXCell, USA) at a final concentration of 6 µg/mL for 5 days. Proliferation was evaluated at the end of the culture period using flow cytometry for CFSE dilution.
+ Open protocol
+ Expand
2

IFNγ Production Assay for T Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
IFNγ was measured as described from BDC2.5 cells 4h after 500μg i.v. of acetylated p31 peptide (YVRPLWVRME) (Genemed Sythesis) or OT-I cells after 1μg/ml SIINFEKL ex vivo for 4h (New England Peptide) [10 (link), 11 (link)].
+ Open protocol
+ Expand
3

Peptide Vaccination Enhances Antitumor Immunity

Check if the same lab product or an alternative is used in the 5 most similar protocols
KP LucOS mice were vaccinated s.c. at the tail-base with 30 amino acid long peptides containing SIINFEKL and SIYRYYGL (10 nmol; New England Peptide) and cyclic-di-GMP adjuvant (0.25 mg/ml; Invitrogen) at 6 wks post-tumor initiation. An equivalent booster dose was given 2 wks later, and the mice were sacrificed at 9 wks post-tumor initiation for endpoint analysis. All doses were delivered in two 50 μL boluses and control mice received PBS. The long peptide sequences used were: SMLVLLPDEVSGLEQLESIINFEKLTEWTS and GRCVGSEQLESIYRYYGLLLKERSEQKLIS (New England Peptide).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!