Cqdsetrtfy

Peptides RKRRQtSM, RQSVELHsPQSLPR, RGDC, RPHERNGFTVLCPKN, HCLGKWLGHPDKF, NTWTTCQSIAFPSK, and SHLVEALYLVCGERG were purchased from Anaspec (San Jose, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA). CDPGYIGSR was purchased from Apexbio, and CGYGPKKKRKVGG was purchased from American Peptide Company (Sunnyvale, CA). GSNKGAIIGLM (Piscataway, NJ) was purchased from GenScript. DRVYIHPF was purchased from Sigma-Aldrich (St. Louis, MO). Naphthoquinone (NQ), iodoacetamide and dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Benzoquinone (BQ), benzyl mercaptan (BM), and trifluoroacetic acid (TFA) were purchased from Alfa Aesar (Haverhill, MA). Naphthalenethiol (NT) was purchased from Fluka Analytical (Mexico City, Mexico). Iodomethane was purchased from Arcos Organics (Geel, Belgium). Chloramine-T, sodium metabisulfite, and sodium iodide were purchased from Fisher Chemical (Fairlawn, NJ). Acetonitrile (ACN) and methanol were purchased from Fisher Scientific (Waltham, MA). Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A Macrotrap holder and Macrotrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc (Auburn, CA).

Peptides RGDC, VTCG, PHCKRM, YGLSKGCFGLKLDRIGSMSGLGC, and SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY were purchased from American Peptide Company (Sunnyvale, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA) and CDPGYIGSR was purchased from Apexbio. Ammonium bicarbonate was purchased from Avantor (Center Valley, PA). Dithiothreitol was purchased from Arcos Organics (Geel, Belgium). Dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Trifluoroacetic acid (TFA) and N,N’-Dicyclohexylcarbodiimide was purchased from Alfa Aesar (Haverhill, MA). Acetonitrile (ACN), methanol and 1,4 dioxane were purchased from Fisher Scientific (Waltham, MA). 2-hydroxymethyl-18-crown-6 ether was purchased from TCI America (Portland, OR) and 3,5-diiodobenzoic acid was purchased commercially. Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A MacroTrap holder and MacroTrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc. (Auburn, CA).