The largest database of trusted experimental protocols

Cdpgyigsr

Manufactured by Apexbio

CDPGYIGSR is a peptide sequence that can be used in various laboratory applications. It is composed of the amino acids cysteine, aspartic acid, proline, glycine, tyrosine, isoleucine, glycine, serine, and arginine. The core function of this peptide is to serve as a tool for research purposes, but a detailed description of its intended use cannot be provided while maintaining an unbiased and factual approach.

Automatically generated - may contain errors

2 protocols using cdpgyigsr

1

Diverse Peptide Synthesis and Characterization

Check if the same lab product or an alternative is used in the 5 most similar protocols
Peptides RKRRQtSM, RQSVELHsPQSLPR, RGDC, RPHERNGFTVLCPKN, HCLGKWLGHPDKF, NTWTTCQSIAFPSK, and SHLVEALYLVCGERG were purchased from Anaspec (San Jose, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA). CDPGYIGSR was purchased from Apexbio, and CGYGPKKKRKVGG was purchased from American Peptide Company (Sunnyvale, CA). GSNKGAIIGLM (Piscataway, NJ) was purchased from GenScript. DRVYIHPF was purchased from Sigma-Aldrich (St. Louis, MO). Naphthoquinone (NQ), iodoacetamide and dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Benzoquinone (BQ), benzyl mercaptan (BM), and trifluoroacetic acid (TFA) were purchased from Alfa Aesar (Haverhill, MA). Naphthalenethiol (NT) was purchased from Fluka Analytical (Mexico City, Mexico). Iodomethane was purchased from Arcos Organics (Geel, Belgium). Chloramine-T, sodium metabisulfite, and sodium iodide were purchased from Fisher Chemical (Fairlawn, NJ). Acetonitrile (ACN) and methanol were purchased from Fisher Scientific (Waltham, MA). Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A Macrotrap holder and Macrotrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc (Auburn, CA).
+ Open protocol
+ Expand
2

Peptide Synthesis and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Peptides RGDC, VTCG, PHCKRM, YGLSKGCFGLKLDRIGSMSGLGC, and SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY were purchased from American Peptide Company (Sunnyvale, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA) and CDPGYIGSR was purchased from Apexbio. Ammonium bicarbonate was purchased from Avantor (Center Valley, PA). Dithiothreitol was purchased from Arcos Organics (Geel, Belgium). Dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Trifluoroacetic acid (TFA) and N,N’-Dicyclohexylcarbodiimide was purchased from Alfa Aesar (Haverhill, MA). Acetonitrile (ACN), methanol and 1,4 dioxane were purchased from Fisher Scientific (Waltham, MA). 2-hydroxymethyl-18-crown-6 ether was purchased from TCI America (Portland, OR) and 3,5-diiodobenzoic acid was purchased commercially. Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A MacroTrap holder and MacroTrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc. (Auburn, CA).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!