Hpv16 e7 peptide

Manufactured by GL Biochem

The HPV16 E7 peptide is a synthetic peptide derived from the E7 protein of the Human Papillomavirus (HPV) type 16. This peptide is commonly used in research applications, such as the development of diagnostic tests and vaccines targeting HPV-related diseases.

Automatically generated - may contain errors

Lab products found in correlation

Cpg odn 1826, by Sangon (2 mentions)

2 protocols using hpv16 e7 peptide

HPV16 E7 Peptide and CpG ODN Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols

The HPV16 E7 peptide (E7 43–77: GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) was provided by GL Biochem (Shanghai) Ltd. (Shanghai, China). The purity of the peptide was verified by high-performance liquid chromatography and was found to be routinely >95%. CpG ODN 1826 (5ʹ-TCCATGACGTTCCTGACGTT-3ʹ) was synthesized by Sangon Biotech (Shanghai) Co. Ltd. (Shanghai, China).

Che Y., Yang Y., Suo J., Chen C, & Wang X. (2021). Intratumoral Injection of a Human Papillomavirus Therapeutic Vaccine-Induced Strong Anti-TC-1-Grafted Tumor Activity in Mice. Cancer Management and Research, 13, 7339-7354.

+ Open protocol

+ Expand

Synthesis of HPV16 E7 Peptide and CpG-ODN

Check if the same lab product or an alternative is used in the 5 most similar protocols

The HPV16 E7 peptide (E7 43–77) was synthesized by GL Biochem (Shanghai) Ltd (Shanghai, China). CpG ODN 1826 was synthesized by Sangon Biotech (Shanghai) Co. Ltd (Shanghai, China). The sequences of the peptide and CpG ODN were as follows:
E7 43–77: GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR; CpG-ODN1826: 5′-TCCATGACGTTCCTGACGTT-3′.

Wang H., Che Y., Yang Y., Suo J, & Wang X. (2021). Inhibition of Orthotopic Genital Cancer Induced by Subcutaneous Administration of Human Papillomavirus Peptide Vaccine with CpG Oligodeoxynucleotides as an Adjuvant in Mice. Cancer Management and Research, 13, 5559-5572.

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!