Hpv16 e7 peptide
The HPV16 E7 peptide is a synthetic peptide derived from the E7 protein of the Human Papillomavirus (HPV) type 16. This peptide is commonly used in research applications, such as the development of diagnostic tests and vaccines targeting HPV-related diseases.
Lab products found in correlation
2 protocols using hpv16 e7 peptide
HPV16 E7 Peptide and CpG ODN Protocol
Synthesis of HPV16 E7 Peptide and CpG-ODN
E7 43–77: GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR; CpG-ODN1826: 5′-TCCATGACGTTCCTGACGTT-3′.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!