House dust mites (HDM, ALK-Abello A/S, Denmar), Recombinant Human long-isoform TSLP (lTSLP) was obtained from R&D systems. Synthetic sfTSLP peptides (63aa: MFAMKTKAALAI WCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ) were prepared by China Peptides (Shanghai, China). 3-PO (3-(3-pyridinyl)-1-(4-pyridinyl)-2-propen-1-one) and BAY 87-2243 (Selleck, China). Rabbit anti-HIF-1α, anti-LDHA, anti-PHD and anti-VHL (proteintech, China), Rabbit anti-STAT5, anti-p-STAT5, anti-JAK1, anti-p-JAK1, anti-JAK2and anti-p-JAK2 (Cell Signaling Technology, USA), Rabbit anti-TSLPR and mouse anti-IL-7R (santa curz, USA). Rabbit anti-TSLP (Abcam, USA).
Rabbit anti tslp
Manufactured by Abcam
Sourced in United States
Rabbit anti-TSLP is a primary antibody that specifically binds to the Thymic Stromal Lymphopoietin (TSLP) protein. TSLP is a cytokine that plays a role in immune system regulation. This antibody can be used for the detection and quantification of TSLP in various research applications.
Automatically generated - may contain errors
Lab products found in correlation
Anti p stat5, by Cell Signaling Technology (1 mentions)
Anti ldha, by Proteintech (1 mentions)
Rabbit anti hif 1α, by Proteintech (1 mentions)
Rabbit anti stat5, by Cell Signaling Technology (1 mentions)
Bay 87 2243, by Selleck Chemicals (1 mentions)
Anti p jak1, by Cell Signaling Technology (1 mentions)
Anti jak1, by Cell Signaling Technology (1 mentions)
Anti p jak2, by Cell Signaling Technology (1 mentions)
Anti jak2, by Cell Signaling Technology (1 mentions)
Hrp conjugated goat anti rabbit igg, by Proteintech (1 mentions)
Rabbit anti gapdh, by Proteintech (1 mentions)
Ecl reagent, by Thermo Fisher Scientific (1 mentions)
0.45 μm polyvinylidene difluoride membrane, by Merck Group (1 mentions)
Fusion fx5 image analysis system, by Vilber (1 mentions)
Rabbit anti tslpr, by Merck Group (1 mentions)
Bca protein assay kit, by Dingguo (1 mentions)
2 protocols using rabbit anti tslp
1
Investigating TSLP Signaling in HDM-Induced Inflammation
2
Western Blot Analysis of Brain Proteins
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Total protein from the brains of normal, sham, and stroke animals was extracted as described above. Protein concentrations were measured using a BCA Protein Assay Kit (Dingguo, Beijing, China). A total of 50 µg of protein from each sample was loaded into each lane of SDS-PAGE gels. Gel electrophoresis was performed, followed by transfer of the proteins onto a 0.45-μm polyvinylidene difluoride membrane (Millipore). The membrane was blocked in nonfat milk and probed with the primary and secondary antibodies. The following antibodies were used: rabbit anti-TSLPR (1 : 1000; Millipore), rabbit anti-TSLP (1 : 1000; Abcam), rabbit anti-IL-7R (1 : 1000; Abcam), rabbit anti-STAT5 (1 : 1000; Abcam), rabbit anti-GAPDH (1 : 1000; Proteintech, Chicago, Illinois, USA), and HRP-conjugated goat anti-rabbit IgG (1 : 1000, Proteintech). The blots were washed in TBST and the bands were visualized using ECL reagent (Thermo, New Tork City, New York, USA) and a Fusion FX5 image analysis system (Vilber Lourmat, Collégien, France). Relative protein expression levels were normalized to the GAPDH signal.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!