The largest database of trusted experimental protocols

8 protocols using sc19220

1

TLR9 Activation and Regulation Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
LPS was from E. coli O55:B5 (Sigma). Synthetic oligodeoxynucleotides (ODNs) were from Invitrogen and were resuspended in endotoxin-free Tris-EDTA buffer. The sequences of ODNs for positive activation of TLR9 at the indicated concentrations are: murine-specific CpG ODN 5′-TCCATGACGTTCCTGACGTT-3′ (CpG-1826, also referred to as CpG if not specifically indicated by types), human-specific CpG ODN 2216 5′-ggGGGACGATCGTCgggggg-3′ (CpG-2216, lowercase letters represent phosphorothioate linkage; capitals, phosphodiester linkage 3′ of the base). The sequence for non-nCpG control ODN 1982: 5′-TCCAGGACTTCTCTCAGGTT-3′ (nCpG). To prevent TLR9 and CpG colocalization in endosomal vesicles, thereby inhibiting TLR9 activation by its agonist, we pretreated cells with the inhibitory iCpG ODN 2088: 5′-TCCTGGCGGGGAAGT-3′ (iCpG) at the indicated concentrations for 30 min prior to stimulation with agonists. IL-10 and anti-mouse IL-10 mAb were from R&D systems. Cycloheximide (CHX), SB202190, U0126, JNK inhibitor II, LY294002, AG490, prostaglandin E2 (PGE2), indomethacin (Indo), and NS398 were from Calbiochem. Ruxolitinib was obtained from Selleck Chemicals. EP receptor antagonists SC-19220, AH-6809, and AH-2348 were from Sigma. PhosphoPlus Stat3 (Tyr705) antibody kit, including anti-phospho-Stat3 Ab, anti-Stat3 Ab, and untreated and IFNα-treated HeLa cell extracts, was from Cell Signaling.
+ Open protocol
+ Expand
2

Vascular Pharmacology of Prostanoid Signaling

Check if the same lab product or an alternative is used in the 5 most similar protocols
L-NAME, ACh, PE, the EP3 antagonist L798106, and the EP1 antagonist SC19220 were purchased from Sigma (St Louis, MO, USA). The COX-1 selective inhibitor FR122047, the IP antagonist CAY10441, the TP antagonist SQ29548, TP agonist U46619, PGI2 and standard compounds of COX products were bought from Cayman Chemical (Ann Arbor, MI, USA). The selective COX-2 inhibitor rofecoxib was purchased from US Biological (Salem, MA, USA). L-NAME, PE, ACh, and FR122047 were dissolved in distilled water, while PGI2 was dissolved in carbonate buffer (50 mM, pH 10.0). SQ29548, L798106, SC19220, CAY10441, and rofecoxib were dissolved in DMSO at 2,000-fold working concentration (the final concentration of DMSO was 0.05/100, v/v). The concentration of an inhibitor or antagonist used was based on previous reports, in which a selective inhibition of the effect of its intended target was considered to be achieved23 (link), 35 , 45 (link), 46 (link), 50 (link), 51 (link).
The composition of physiological salt solution (PSS; pH 7.4 with 95%O2-5% CO2) was as follows (in mM): NaCl 123, KCl 4.7, NaHCO3 15.5, KH2PO4 1.2, MgCl2 1.2, CaCl2 1.25, and D-glucose 11.5. The 60 mM K+-PSS (K+) was prepared by replacing an equal molar of NaCl with KCl.
+ Open protocol
+ Expand
3

Murine Arachidonic Acid Metabolism

Check if the same lab product or an alternative is used in the 5 most similar protocols
LTD4, PGE2 and murine COX-2 were purchased from Cayman Chemical (Ann Arbor, MI). Non-essential amino acids, FBS, BSA, Fura-2 acetoxymethylester (Fura-2 AM), U73122, dantrolene, Gö 6983, ketoprofen, LY 171883, MK 571, NS 398, SC560 and SC19220, PD98059, ethidium bromide and acridine orange were purchased from Sigma Chemical (St. Louis, MO). LY 255283 was purchased from Tocris Biosc. (Bristol, UK). Arachidonyl trifluoromethylketone (AACOCF3) and bromoenol lactone (BEL) were acquired from Alexis Corp. (San Diego, CA). [Methyl-3H]thymidine (20 Ci/mmol) and [5,6,8,9,11,12,-14,15-3H] arachidonic acid ([3H]AA) (60-100 Ci/mmol) were from American Radiolabeled Chemicals Inc. (St. Louis, MO), and AH 23838 was kindly provided by Glaxo-Wellcome (Stevenage, UK).
+ Open protocol
+ Expand
4

Pharmacological Modulators of Cell Signaling

Check if the same lab product or an alternative is used in the 5 most similar protocols
AH23848 hemicalcium salt (A8227), AH6809 (A1221), bisindolylmaleimide (Bis, B3931), cis-4,7,10,13,16,19-Docosahexaenoic acid (DHA, D2534), dibutyryl cyclic AMP (db-cAMP, D0627), Ethylene glycol-bis(2-aminoethylether)-N,N,N?,N?-tetraacetic acid (EGTA, E4378), 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES, H3375), Insulin (I4011), Phorbol 12-myristate 13-acetate (PMA, P8139), poly-l-lysine (P2636), Prostaglandin E2 (PGE2, P5640) and SC 19220 (S3065) were all purchased from Sigma-Aldrich (St. Louis, MO, USA). L-798, 106 (cat. no. 3342) was from Tocris Bioscience (Bristol, UK). DMEM (12100-046), Foetal calf serum (10099-141), and the antibiotic–antimycotic (15240-062) solution were all purchased from Gibco Life Technologies (Grand Island, NY, USA).
+ Open protocol
+ Expand
5

MCF7 Cell Line Characterization and Culture

Check if the same lab product or an alternative is used in the 5 most similar protocols
MCF7 cell line was purchased from the Egyptian company for production of vaccines, sera, and drugs (VACSERA, Cairo, Egypt). Cells were verified by karyotyping analysis according to American Type Culture Collection (ATCC) Guidelines. MCF7 cells were cultured in Roswell Park Memorial Institute Medium (RPMI 1640) (Gibco®, USA) supplemented with 10 % heat-inactivated fetal bovine serum (FBS) (Gibco®, USA) and 1% penicillin/streptomycin (Gibco®, USA).
17-phenyl trinor-prostaglandin E2 (17-PT-PGE2) as EP1 agonist, PD98059, as MEK inhibitor, and Bisindolylymaleimide I (GF109203X) as PKC inhibitor, were all purchased from SantaCruiz Biotechnology, Inc (USA). SC-19220 as EP1 antagonist and ammonium pyrrolidinedithiocarbamate (PDTC) as NF-ҡB inhibitor were obtained from Sigma-Aldrich (USA).
Ca2+ Mg2+ free phosphate-buffered saline (PBS) was obtained from Lonza Verviers Sprl® (Belgium), phenol red-free RPMI 1640 media was purchased from Lonza® (USA), Dimethyl Sulfoxide (DMSO) was obtained from S D Fine-Chem Limited Company® (India). Trypsin-ethylenediaminetetraacetic acid (trypsin-EDTA) was obtained from Gibco® (USA) and MTT cell proliferation assay kit was obtained from (Thermo Fisher Scientifc®, USA).
+ Open protocol
+ Expand
6

Examining Connexin and Pannexin Interactions

Check if the same lab product or an alternative is used in the 5 most similar protocols
Gap26, Gap19; YGRKKRRQRRRDGANVDMHLKQIEIKKFKYGIEEHGK (TAT-L2) and 10panx1 peptides were obtained from Genscript (New Jersey, USA). HEPES, DMEM, DNAse I, poly-L-lysine, LN-6, ns-398, sc-19220, polyclonal anti-Cx43 antibody, 3-(2-carboxypiperazin-4-yl)propyl-1-phosphonic acid (CPP), Brilliant blue G (BBG), oATP, ethidium (Etd) bromide, and probenecid (Prob) were purchased from Sigma-Aldrich (St. Louis, MO, USA). Fetal calf serum (FCS) was obtained from Hyclone (Logan, UT, USA). Penicillin, streptomycin, polyclonal anti-Panx1 antibody (PI488000), goat anti-mouse Alexa Fluor 488 and goat anti-mouse Alexa Fluor 555 were obtained from Invitrogen (Carlsbad, CA, USA). Anti-NeuN monoclonal antibody was obtained from Chemicon (Martinsried/Munich, Germany). Normal goat serum (NGS) was purchased from Zymed (San Francisco, CA, USA). Anti-GFAP monoclonal antibody was purchased from ICN Chemicals, (Irvine, CA). Anti-Cx43 monoclonal antibody was obtained from BD Biosciences (Franklin Lakes, NJ, USA).
+ Open protocol
+ Expand
7

Pharmacological Modulators of Cellular Pathways

Check if the same lab product or an alternative is used in the 5 most similar protocols
Phenylephrine, ACh, SC19220, furegrelate, tranylcypromine, L-NAME, ML-171, catalase, lactacystin, SP600125, indomethacin, BQ123 and BQ788 were obtained from Sigma Chemical, Co. NS398 was obtained from Calbiochem-Novabiochem GmbH (Bad Soden, Germany), apocynin from Fluka-Sigma Chemical (Seelze, Germany) and SQ29,548 from Cayman Chemical. Pioglitazone was generously supplied by Takeda-Lilly, Madrid, Spain.
+ Open protocol
+ Expand
8

Angiotensin II-Induced Myofibroblast Activation

Check if the same lab product or an alternative is used in the 5 most similar protocols
Dulbecco's modified Eagle's medium (DMEM), new born calf serum (NBCS), collagenase type II, penicillin/streptomycin, Lipofectamine 2000 and fluo-4/AM were purchased from Life technologies/ Invitrogen (Carlsbad, CA., USA). Anti-NFATc4, anti-FN, anti-α-SMA antibodies were purchased from Santa Cruz Biotechnology (CA, USA). Anti-CTGF, anti-Collagen I antibodies were purchased from Cell Signaling Technology (Boston, MA., USA). Trypsin, 3-(4, 5-dimethylthiazol-2-y1)-2, 5-dipheny-ltetrazolium bromide (MTT), dimethylsulfoxide (DMSO), Anti-α-tubulin antibody, PGE2, NS-398 (specific antagonist of COX-2), SC19220 (specific antagonist of EP1) and L-161,982 (specific inhibitor of EP4) were all purchased from Sigma-Aldrich (St. Louis, MO, USA). Ang II was purchased from Merck Millipore (Billerica, MA, USA).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!