Log In Sign up
The largest database of trusted experimental protocols

Delta 600 hplc system

Manufactured by Waters Corporation
Visit Supplier
Sourced in United States

The Delta 600 HPLC System is a high-performance liquid chromatography (HPLC) instrument designed for analytical and preparative applications. The system features a quaternary solvent delivery system, a column compartment, and a variety of detection options, including UV-Vis, diode array, and refractive index detectors. The Delta 600 HPLC System is capable of performing separations and analyses of a wide range of chemical compounds.

Automatically generated - may contain errors

Lab products found in correlation

Model pioneer, by Thermo Fisher Scientific (4 mentions) Acquity ultra performance lc, by Waters Corporation (1 mentions) Unity inova 400, by Agilent Technologies (1 mentions) Rp c18 column, by Waters Corporation (1 mentions) Micromass detector, by Waters Corporation (1 mentions) 2707 autosampler, by Waters Corporation (1 mentions) Fraction collector 3, by Waters Corporation (1 mentions) Masslynx v4, by Waters Corporation (1 mentions) Xbridge prep c18 column, by Waters Corporation (1 mentions)

7 protocols using delta 600 hplc system

1

Purification and Characterization of Product

Check if the same lab product or an alternative is used in the 5 most similar protocols
We used Waters Delta600 HPLC system, which equipped with an XTerra C18 RP column and an in-line diode array UV detector to purify the product. LC-MS machine we used was a Waters Acquity Ultra Performance LC with Waters MICROMASS detector. Hydrogen nuclear magnetic resonance (NMR) spectra were recorded on a Varian Unity Inova 400 with DMSO as solvent. We used Morgagni 268 transmission electron microscope to take Transmission electron microscope (TEM) images. MTT assay for cell cytotoxicity was test on DTX880 Multimode Detector.
Li J., Du X., Powell D.J., Zhou R., Shi J., He H., Feng Z, & Xu B. (2018). Down-regulating Proteolysis to Enhance Anticancer Activity of Peptide Nanofibers. Chemistry, an Asian journal, 13(22), 3464-3468.
+ Open protocol
+ Expand
2

Rubiscolin-6 Peptide Synthesis and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Rubiscolin-6 (YPLDLF) was synthesized by a solid-phase methodology with Fmoc-strategy using an automated peptide synthesizer (Model Pioneer; Thermo Fisher Scientific, Waltham, Massachusetts, USA). The crude peptide was purified by a reverse-phase HPLC (Delta 600 HPLC System; Waters, Milford, Massachusetts, USA) on a column of Develosil ODS-HG-5 (2 × 25 cm; Nomura Chemical Co., Ltd, Seto, Japan). High purity of the purified peptide was confirmed by analytical HPLC and MALDI-TOF MS analysis.
Kairupan T.S., Cheng K.C., Asakawa A., Amitani H., Yagi T., Ataka K., Rokot N.T., Kapantow N.H., Kato I, & Inui A. (2018). Rubiscolin-6 activates opioid receptors to enhance glucose uptake in skeletal muscle. Journal of Food and Drug Analysis, 27(1), 266-274.
+ Open protocol
+ Expand
3

Preparative RP-HPLC Purification of Dendrimer Conjugates

Check if the same lab product or an alternative is used in the 5 most similar protocols
Semi-preparative rp-HPLC was performed on Waters Delta 600 HPLC system equipped with a Waters 2998 photodiode array detector, a Waters 2707 autosampler, and Waters Fraction collector III. The instrument was controlled by Empower 2 software. For isolation of the conjugates, a C5 silica-based rp-HPLC column (250 × 10.0 mm, 300 Å) connected to a C5 guard (10 × 10 mm) was used. The mobile phase for elution of the conjugates was a linear gradient beginning with 100:0 (v/v) water/ACN and ending with 20:80 (v/v) water/ACN over 30 min at a flow rate of 2.75 mL/min. TFA at 0.14 wt % concentration in water as well as in ACN was used as a counterion to make the dendrimer surfaces hydrophobic. The conjugates were dissolved in the mobile phase (90:10 water/ACN). The injection volume was 500 μL with a sample concentration of approximately 5 mg/mL, and the detection of eluted samples was performed at 210 and 488 nm.
Vaidyanathan S., Kaushik M., Dougherty C., Rattan R., Goonewardena S.N., Banaszak Holl M.M., Monano J, & DiMaggio S. (2016). Increase in Dye:Dendrimer Ratio Decreases Cellular Uptake of Neutral Dendrimers in RAW Cells. ACS biomaterials science & engineering, 2(9), 1540-1545.
+ Open protocol
+ Expand
4

Preparative HPLC Purification of Compounds

Check if the same lab product or an alternative is used in the 5 most similar protocols
The preparative HPLC was carried out in a Waters Delta 600 HPLC system connected to a photodiode array detector operating between the UV ranges of 210 – 600 nm with Waters Masslynx V4.1 software. The sample injection loop was 5 mL. The purification was performed on a Waters Xbridge® prep C18 column (10 X 250 mm, 5μm) with 2 mL/min flow rate. The mobile phase consisted of solvent A (95% H2O, 5% MeOH, 0.1% TFA) and solvent B (95% MeOH, 5% H2O, 0.1% TFA). The HPLC gradient started from 0% B to 100% B in 20 min. After staying in 100% B for 5 min, the solvent composition was changed to 0% B in 3 min and maintained at 0% for another 7 min.
Liu F., Amin T.U., Liang D., Park M.S, & Alhamadsheh M.M. (2021). Enhancing the Pharmacokinetic Profile of Interleukin 2 Through Site Specific Conjugation to a Selective Small Molecule Transthyretin Ligand. Journal of medicinal chemistry, 64(19), 14876-14886.
+ Open protocol
+ Expand
5

Synthesis and Purification of Mouse Nesfatin-1 Peptides

Check if the same lab product or an alternative is used in the 5 most similar protocols
Mouse nesfatin-1 was synthesized by solid-phase methodology with 9-fluorenylmethoxycarbonyl using an automated peptide synthesizer (Model Pioneer; Thermo Fisher Scientific, Inc.). The crude peptide was purified by reverse-phase high-performance liquid chromatography (HPLC; Delta 600 HPLC system; Waters Corporation) using a Develosil 300 ODS-HG-5 column (2×25 cm; Nomura Chemical Co., Ltd.). Mouse C-terminal nesfatin-1 Cys-(48 (link)–82) and mouse N-terminal nesfatin-1 (1 (link)–35 (link))-RRC were also synthesized in a manner similar to that described above. The purity of the synthetic peptides was confirmed by analytical HPLC, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry and amino acid analysis.
Tagawa N., Ogura H., Miyawaki H., Asakawa A, & Kato I. (2022). Intraperitoneal administration of nesfatin-1 stimulates glucagon-like peptide-1 secretion in fasted mice. Molecular Medicine Reports, 27(1), 7.
+ Open protocol
+ Expand
6

Synthesis and Characterization of VPAC Receptor Antagonists

Check if the same lab product or an alternative is used in the 5 most similar protocols
Xenin25 (MLTKFETKSARVKGLSFHPKRPWIL), the VPAC1 receptor antagonist PG97‐269, and the VPAC2 receptor antagonist PG99‐465 were synthesized using solid‐phase methodology according to the F‐moc strategy with an automated peptide synthesizer (Model Pioneer Thermo Fisher Scientific, Waltham, MA, USA). The crude peptides were purified using reverse‐phase HPLC (Delta 600 HPLC System; Waters, Milford, MA, USA) on a Develosil ODS‐HG‐5 column (2 × 25 cm, Nomura Chemical Co., Ltd, Seto, Japan). The purity of each peptide was confirmed by analytical HPLC and matrix‐assisted laser desorption/ionization time‐of‐flight and mass spectrometry.
Kuwahara Y., Kato I., Inui T., Marunaka Y, & Kuwahara A. (2021). The effect of Xenin25 on spontaneous circular muscle contractions of rat distal colon in vitro. Physiological Reports, 9(4), e14752.
+ Open protocol
+ Expand
7

Musclin Peptide Synthesis and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Musclin (SFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG; molecular weight: 5627.4) was synthesized via a solid-phase methodology according to the Fmoc strategy using an automated peptide synthesizer (Model Pioneer, Thermo Fisher Scientific, Waltham, MA, USA). The crude peptide was purified by reverse-phase HPLC (Delta 600 HPLC System, Waters, MA, USA) using a Develosil ODS-HG-5 column (2 × 25 cm, Nomura Chemical Co., Ltd., Aichi, Japan). The purity of the peptide was confirmed using analytical HPLC, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS), and amino acid analysis.
Ataka K., Asakawa A., Iwai H, & Kato I. (2023). Musclin prevents depression-like behavior in male mice by activating urocortin 2 signaling in the hypothalamus. Frontiers in Endocrinology, 14, 1288282.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!