Log In Sign up
The largest database of trusted experimental protocols

Ni2 nitrilotriacetic acid nta resin

Manufactured by GE Healthcare
Visit Supplier

Ni2+-nitrilotriacetic acid (NTA) resin is a chromatographic material used for the purification of recombinant proteins. It contains a nickel-chelated nitrilotriacetic acid ligand that binds to proteins with a histidine-tag, allowing for selective capture and purification.

Automatically generated - may contain errors

Lab products found in correlation

Expi293, by Thermo Fisher Scientific (2 mentions) Superdex 200 pg, by GE Healthcare (1 mentions) Glutathione sepharose 4 column, by GE Healthcare (1 mentions)

3 protocols using ni2 nitrilotriacetic acid nta resin

1

Foldon-minifibritin Protein Expression and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
A mammalian codon-optimized plasmid encoding foldon inserted minifibritin (ADIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQEAGYIPEAPRDGQAYVRKDGEWVLLSTFLSPALVPRGSHHHHHHSAWSHPQFEK) with a C-terminal thrombin cleavage site, 6x His-tag, and Strep-TagII was synthesized and subcloned into a mammalian expression vector derived from pLEXm. The construct was expressed by transient transfection of Expi293 (ThermoFisher) cells in suspension at 37°C for 5 days. The protein was first purified with a Ni2+-nitrilotriacetic acid (NTA) resin (GE Healthcare,) using an elution buffer consisting of 50 mM Tris-HCl, pH 7.5, 400 mM NaCl, and 300 mM imidazole, pH 8.0, followed by purification with StrepTactin resin (IBA) according to the manufacturer’s instructions.
Corbett K.S., Edwards D.K., Leist S.R., Abiona O.M., Boyoglu-Barnum S., Gillespie R.A., Himansu S., Schäfer A., Ziwawo C.T., DiPiazza A.T., Dinnon K.H., Elbashir S.M., Shaw C.A., Woods A., Fritch E.J., Martinez D.R., Bock K.W., Minai M., Nagata B.M., Hutchinson G.B., Wu K., Henry C., Bahi K., Garcia-Dominguez D., Ma L., Renzi I., Kong W.P., Schmidt S.D., Wang L., Zhang Y., Phung E., Chang L.A., Loomis R.J., Altaras N.E., Narayanan E., Metkar M., Presnyak V., Liu C., Louder M.K., Shi W., Leung K., Yang E.S., West A., Gully K.L., Stevens L.J., Wang N., Wrapp D., Doria-Rose N.A., Stewart-Jones G., Bennett H., Alvarado G.S., Nason M.C., Ruckwardt T.J., McLellan J.S., Denison M.R., Chappell J.D., Moore I.N., Morabito K.M., Mascola J.R., Baric R.S., Carfi A, & Graham B.S. (2020). SARS-CoV-2 mRNA Vaccine Design Enabled by Prototype Pathogen Preparedness. Nature, 586(7830), 567-571.
+ Open protocol
+ Expand
2

Purification and Crystallization of MICAL1 and MyoV

Check if the same lab product or an alternative is used in the 5 most similar protocols
MyoVaGTD, MyoVbGTD, MICAL1 with different boundaries, Spir2GTBM, Rab11a1–177, and all the mutants were overexpressed by an induction of 0.2 mM isopropyl-β-d-thiogalactopyranoside (IPTG) at 16°C overnight in BL21(DE3) Escherichia coli cells. The thioredoxin (Trx)–His–fused proteins were purified by using Ni2+–nitrilotriacetic acid (NTA) resin (GE Healthcare), and the GST-fused proteins were purified by glutathione Sepharose 4 column (GE Healthcare), followed by size exclusion chromatography (Superdex 200 pg, GE Healthcare) with a buffer of 50 mM tris (pH7.5), 100 mM NaCl, 1 mM DTT, and 1 mM EDTA. For crystallization, Trx-His–fused MyoVaGTD and MICAL1GTBM were treated with 3C protease overnight at 16°C to remove the fused tags and then further purified by a second Ni2+-NTA affinity chromatography, followed by SEC.
Niu F., Sun K., Wei W., Yu C, & Wei Z. (2020). F-actin disassembly factor MICAL1 binding to Myosin Va mediates cargo unloading during cytokinesis. Science Advances, 6(45), eabb1307.
+ Open protocol
+ Expand
3

Foldon-minifibritin Protein Expression and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
A mammalian codon-optimized plasmid encoding foldon inserted minifibritin (ADIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQEAGYIPEAPRDGQAYVRKDGEWVLLSTFLSPALVPRGSHHHHHHSAWSHPQFEK) with a C-terminal thrombin cleavage site, 6x His-tag, and Strep-TagII was synthesized and subcloned into a mammalian expression vector derived from pLEXm. The construct was expressed by transient transfection of Expi293 (ThermoFisher) cells in suspension at 37°C for 5 days. The protein was first purified with a Ni2+-nitrilotriacetic acid (NTA) resin (GE Healthcare,) using an elution buffer consisting of 50 mM Tris-HCl, pH 7.5, 400 mM NaCl, and 300 mM imidazole, pH 8.0, followed by purification with StrepTactin resin (IBA) according to the manufacturer’s instructions.
Corbett K.S., Edwards D.K., Leist S.R., Abiona O.M., Boyoglu-Barnum S., Gillespie R.A., Himansu S., Schäfer A., Ziwawo C.T., DiPiazza A.T., Dinnon K.H., Elbashir S.M., Shaw C.A., Woods A., Fritch E.J., Martinez D.R., Bock K.W., Minai M., Nagata B.M., Hutchinson G.B., Wu K., Henry C., Bahi K., Garcia-Dominguez D., Ma L., Renzi I., Kong W.P., Schmidt S.D., Wang L., Zhang Y., Phung E., Chang L.A., Loomis R.J., Altaras N.E., Narayanan E., Metkar M., Presnyak V., Liu C., Louder M.K., Shi W., Leung K., Yang E.S., West A., Gully K.L., Stevens L.J., Wang N., Wrapp D., Doria-Rose N.A., Stewart-Jones G., Bennett H., Alvarado G.S., Nason M.C., Ruckwardt T.J., McLellan J.S., Denison M.R., Chappell J.D., Moore I.N., Morabito K.M., Mascola J.R., Baric R.S., Carfi A, & Graham B.S. (2020). SARS-CoV-2 mRNA Vaccine Design Enabled by Prototype Pathogen Preparedness. Nature, 586(7830), 567-571.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!