Dopamine hydrochloride (DA), tris(hydroxymethyl)aminomethane (TRIS), Streptavidin (SA), WST-1 Cell Proliferation Reagent, ammonium hydroxide solution (NH4OH, 25 %), gentamicin, Poly-L-lysine solution (0.1 % w/v in H2O) and 2-mercaptoethanol were purchased from Sigma-Aldrich. mPEG-SH (2 kDa) and biotin-PEG-SH (2 kDa,) were purchased from NANOCS. RPMI 1640 was purchased from Lonza. L-glutamine was purchased from Gibco. 10 % heat-inactivated fetal calf serum was purchased from BioScience. GM-CSF was purchased from Peprotech. Anti-mouse CD11c-FITC was purchased from eBioscience. Poly-L-lysine was purchased from Invitrogen. Fluorescent nanodiamonds were supplied by Adamas Nanotechnologies and Columbus NanoWorks. Deionized (DI) water with a resistivity of 18.2 MΩ·cm was from Milli-Q Water Purification System.
Mpeg sh
Manufactured by Nanocs
Sourced in United States
The MPEG-SH is a lab equipment designed for the analysis and processing of MPEG video data. It is a specialized device that provides core functionality for working with MPEG video formats.
Automatically generated - may contain errors
Lab products found in correlation
Ammonium hydroxide solution, by Merck Group (1 mentions)
Poly l lysine (pll), by Thermo Fisher Scientific (1 mentions)
Gm csf, by Thermo Fisher Scientific (1 mentions)
Cell proliferation reagent wst 1, by Merck Group (1 mentions)
Anti mouse cd11c fitc, by Thermo Fisher Scientific (1 mentions)
L glutamine, by Thermo Fisher Scientific (1 mentions)
Poly l lysine solution, by Merck Group (1 mentions)
2 mercaptoethanol, by Merck Group (1 mentions)
Streptavidin, by Merck Group (1 mentions)
Gentamicin, by Merck Group (1 mentions)
Dopamine hydrochloride, by Merck Group (1 mentions)
Rpmi 1640, by Lonza (1 mentions)
Biotin peg sh, by Nanocs (1 mentions)
Envision hrp, by Agilent Technologies (1 mentions)
10 nm spherical aunps, by Ted Pella (1 mentions)
Hrp polymer kit, by Biocare Medical (1 mentions)
Rat anti brdu, by Abcam (1 mentions)
Asp175, by Cell Signaling Technology (1 mentions)
Hepg2, by American Type Culture Collection (1 mentions)
Hep3b, by American Type Culture Collection (1 mentions)
5 protocols using mpeg sh
1
Nanoparticle-based Cell Proliferation Assay
2
Characterization of Hepatocellular Carcinoma Cell Lines
3
PEGylation of Citrate-Stabilized AuNPs
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Citrate-stabilized spherical AuNPs (100 nm, Ted Pella) were sonicated to ensure particles were well-separated before functionalization. To functionalize AuNPs with PEG, AuNPs at a concentration of 5.6 × 109 NPs/mL were incubated overnight with 11.6 μM (end concentration) of methoxy-terminated thiolated PEG (mPEG-SH, MW = 5000 Da, NanoCS). To ensure optimal surface coverage of PEG, the solution was progressively raised to 10-mM sodium phosphate, 0.1 % v/v Tween 20, and 0.1 M NaCl and incubated overnight. Excess PEG molecules were then removed by three washing steps of centrifugation at 3000g for 30 min followed by re-suspension in milliQ water. PEGylated AuNPs were stored at 4 °C until use.
4
Functionalized AuNPs Characterization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
AuNPs, Dulbecco’s Phosphate Buffer Saline (PBS), DL-Dithiothreitol (DTT), Tert-butanol, and 50 kDa microdialysis membranes were purchased from Sigma-Aldrich (St. Louis, MO). Nap-10 G-25 Sephadex Columns were obtained from GE Lifesciences (Pittsburgh, PA). DSPE-PEG-2000 (1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000]), DOPC (1,2-dioleoyl-sn-glycero-3-phosphocholine), and cholesterol were purchased at Avanti Polar Lipids (Alabaster, AL). DSPE-PEG-Maleimide and mPEG-SH (SH=thiol or sulfhydryl group) were purchased from Nanocs (New York, NY). RVG (YTIWMPENPRPGTPCDIFTNSRGKRASNG) was purchased from Anaspec (Freemont, CA), ApoE (CGRLVQYRG-EVQAMLGQSTEELRVRLASHLRKLRKRLLRD) was purchased from Lifetein (Somerset, NJ). mirVana oligonucleotide miRNA inhibitors (OMIs) were purchased from Thermo Fisher (Waltham, MA) which includes the Negative Control #1, SH-Negative Control #1 (5ʹ-sequence-SH-3ʹ), OMIs-miR-92b, SH-OMIs-miR-92b (MIMAT0003218), Negative Control #1-Alexa-Fluor 647, and SH-Negative Control #1-Alexa-Fluor 647 (5ʹ-Alexa-Fluor 647-sequence-SH-3ʹ). 2-mercaptoethanol (2-ME) was purchased from Bio-Rad (Berkeley, CA). The “Measure-IT Thiol Assay Kit” was purchased from Thermo Fisher, and the “Maleimide Quantification Assay Kit” was purchased from Abcam (Cambridge, UK).
5
Synthesis and Characterization of Europium-doped Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Calcium nitrate tetrahydrate, (Ca(NO3)2.4H2O, 99%, Alfa Aesar), ammonium molybdate (H8MoN2O4, 99.99%, Alfa Aesar, Ward Hill, MA, USA), europium(III) nitrate hydrate (Eu(NO3)3 .xH2O, 99.99%, Sigma Aldrich, St. Louis, MO, USA), oleic acid (Alfa Aesar), 1-octadecene (95%, Alfa Aesar), NaOH pellet (Merck, Kenilworth, NJ, USA), hydrochloric acid (HCl, Sigma-Aldrich), HS-PEG-COOH (MW = 5000, NANOCS, New York, NY, USA), mPEG-SH (MW = 5000, NANOCS), N-(3-dimethylaminopropyl)-N′-ethylcarbodiimide hydrochloride (C8H17N3HCl, MW = 191.7 g mol–1, Sigma-Aldrich) (EDC), N-hydroxysuccinimide (C4H5NO3, Sigma-Aldrich, MW = 115.09 g mol–1) (NHS), 4-mercaptobenzoic acid (MBA) (Sigma-Aldrich), anti-human epidermal growth factor receptor (EGFR) antibody (Thermo Fisher Scientific, Waltham, MA, USA), and phosphate buffered saline (1×) (PBS) (Thermo Fisher Scientific) were used for HNP synthesis. Human (Homo sapiens) lung carcinoma (A549 cells) (ATCC, USA), mouse hepatocyte cells (AML12, normal hepatocyte from liver tissue), ethylenediaminetetraacetic acid (EDTA) stabilized human whole blood was freshly obtained from Innovative Research (Novi, MI, USA), 0.5% trypsin-EDTA solution (Life Technologies), LIVE/DEAD viability/cytotoxicity assay kit (Life Technologies), Earle’s balanced salt solution (EBSS) (Life Technologies) and PBS were used for cell experiments.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!