The largest database of trusted experimental protocols

Lanthanum la3 chloride

Manufactured by Merck Group
Sourced in Israel, United States

Lanthanum (La3+) chloride is a chemical compound that consists of lanthanum ions (La3+) and chloride ions (Cl-). It is a white crystalline solid that is commonly used in various laboratory applications. Lanthanum chloride serves as a source of lanthanum ions, which can be used in scientific research and analysis as a reagent or as a component in specialized laboratory equipment and instruments.

Automatically generated - may contain errors

4 protocols using lanthanum la3 chloride

1

Angiotensin II Signaling Pathways

Check if the same lab product or an alternative is used in the 5 most similar protocols
Angiotensin II (AngII) was obtained from Alomone (Jerusalem, Israel); Fasudil, Y-27632, ethidium (Etd+) bromide, lanthanum (La3+) chloride, Losartan and malondialdehyde (MDA) were obtained from Sigma-Aldrich (St. Louis, MO, USA); Gap27—a peptide that inhibits Cx43 HCs—was obtained from NeoMPS, SA (Strasbourg, France); A740003—a specific P2X7Rblocker—was obtained from Tocris Biosciences (Bristol, UK). The monoclonal anti-α-tubulin antibody was obtained from Sigma-Aldrich (St. Louis, MO, USA); the polyclonal anti-phosphorilated-MYPT1 (Thr696) antibody was obtained from Merck Millipore (Darmstadt, Germany); the monoclonal anti-MYPT1 antibody was obtained from BD Transduction Laboratories (San José, CA, USA); the monoclonal anti-unphosphorylated Cx43 antibody was obtained from Invitrogen (Carlsbad, CA, USA); a polyclonal anti-Panx1 antibody described previously [65 (link)] was used; the polyclonal anti-P2X7R antibody was obtained from Abcam (Cambridge, UK); anti-mouse and anti-rabbit secondary antibodies conjugated to horseradish peroxidase were from Santa Cruz Biotechnology Inc. (Santa Cruz, CA, USA).
+ Open protocol
+ Expand
2

Angiotensin II-Induced Panx1 Activation

Check if the same lab product or an alternative is used in the 5 most similar protocols
Angiotensin II (Ang II) was obtained from Alomone (Jerusalem, Israel), lanthanum (La3+) chloride, penicillin (10,000 U) and streptomycin (10 mg/mL), carbenoxolone (CBX), the monoclonal anti-α-tubulin antibody, probenecid (PBC) and malondialdehyde (MDA) were obtained from Sigma‒Aldrich (St. Louis, MO, United States); 10panx1 (WRQAAFVDSY, first extracellular loop domain of Panx1) was obtained from GenScript (New Jersey, United States); and A740003, a specific P2X7 receptor blocker, was obtained from Tocris Biosciences (Bristol, United Kingdom). The monoclonal anti-unphosphorylated Panx1 antibody was obtained from Invitrogen (Carlsbad, CA, United States); and anti-mouse and anti-rabbit secondary antibodies conjugated to horseradish peroxidase were obtained from Santa Cruz Biotechnology Inc. (Santa Cruz, CA, United States). HEPES, ATP, NaCl, KCl, CaCl2, MgCl2 and glucose were obtained from MERCK (Darmstadt, Germany). Fetal bovine serum (FBS) was purchased from HyClone (Logan, UT, United States), whereas trypsin 10X, Hank’s solution, ATP determination kit, FURA-2 AM Dulbecco’s modified Eagle’s medium (DMEM), phosphate-buffered saline (PBS) and ethidium (Etd) bromide (10 mg/mL) were purchased from Thermo Fisher Scientific (Waltham, MA, United States). 4′,6-Diamidino-2-phenylindole (DAPI) was obtained from Abcam (Cambridge, United Kingdom).
+ Open protocol
+ Expand
3

Lipid Signaling Pathway Characterization

Check if the same lab product or an alternative is used in the 5 most similar protocols
Linoleic acid (LA), GW9508, ethidium (Etd+) bromide and lanthanum (La3+) chloride were obtained from Sigma-Aldrich (St. Louis, MO, USA); Akt inhibitor VIII (AKTi) from Calbiochem (Merck KGaA, Darmstadt, Germany); GPR40 and Negative control siRNA (Neg siRNA) were obtained from Qiagen (Valencia, CA, USA), polyclonal antibodies anti-GPR40 and GPR120 from Abcam (Cambridge, MA, USA). A custom made previously described anti-pS373 Cx43 antibody was used [36 (link)]. Monoclonal antibody anti-α-tubulin was obtained from Sigma-Aldrich, and anti-mouse and anti-rabbit secondary antibodies conjugated to horseradish peroxidase were from Santa Cruz Biotechnology Inc (Santa Cruz, CA, USA).
+ Open protocol
+ Expand
4

Regulation of Connexin 43 Phosphorylation

Check if the same lab product or an alternative is used in the 5 most similar protocols
TNF-α and IL-1β were obtained from Alomone (Jerusalem, Israel); Fasudil, Y-27632, ethidium (Etd+) bromide and lanthanum (La3+) chloride were obtained from Sigma-Aldrich (St. Louis, MO, USA). TBARS assay kit was obtained from Cayman Chemicals (Ann Arbor, MI, USA), and CellTiter96® Non-Radioactive Cell Proliferation Assay was obtained from Promega (Madison, WI, USA). The mimetic peptides gap19 (KQIEIKKFK, intracellular loop domain of Cx43) and TAT-L2 (YGRKKRRQRRRDGANVDMHLKQIEIKKFKYGIEEHGK, second intracellular loop domain of Cx43) were obtained from GenScript (Piscataway Township, NJ, USA) [25 (link)]. The monoclonal anti-α-tubulin antibody was purchased from Sigma-Aldrich (St. Louis, MO, USA). The polyclonal anti-phosphorylated-MYPT1 (Thr696) antibody was obtained from Merck Millipore (Darmstadt, Germany). The monoclonal anti-MYPT1 antibody was purchased from BD Transduction Laboratories (San José, CA, USA). The monoclonal anti-unphosphorylated Cx43 antibody was obtained from Invitrogen (Carlsbad, CA, USA). Anti-mouse and anti-rabbit secondary antibodies conjugated to horseradish peroxidase were from Santa Cruz Biotechnology Inc. (Santa Cruz, CA, USA).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!