The largest database of trusted experimental protocols

5 protocols using apelin 36

1

Coaggregation of Embryonic Progenitor Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
E9.5 and E11.5 embryos were dissected as described (Rybtsov et al., 2014 (link)). Tissues were incubated with collagenase/dispase solution (0.12 mg/mL) (Roche) at 37°C as described (Taoudi et al., 2008 (link)), washed, and resuspended in PBS (Sigma) containing 3% FCS and then dissociated by pipetting. After dissociation (and sorting) 1 e.e. of the specific cell populations (e.g., type I or type II pre-HSCs) were coaggregated with 105 OP9 cells. Five to ten coaggregates (i.e., 5–10 e.e.) per experimental variant were cultured in Iscove's modified Dulbecco's medium (Invitrogen), with 20% of pre-selected, heat-inactivated FCS, L-glutamine, and penicillin/streptomycin supplemented with murine recombinant cytokines (SCF, IL3, and Flt3) each at 100 ng/mL (PeproTech) and various concentrations of APLNR ligand peptides, including APELIN 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF), its cleaved bioactive pyroglutamyl form (Pyr1) APELIN 13 (QRPRLSHKGPMPF), and APELA 21 (LYRHACPRRRCIPLHSRVPFP) (Phoenix Pharmaceuticals). Coaggregates were cultured on floating 0.8 μm AAWP 25 mm nitrocellulose membranes (Millipore) for 6 days then dissociated using collagenase/dispase as described (Rybtsov et al., 2014 (link)).
+ Open protocol
+ Expand
2

Apelin Neuroprotection in Cerebral Ischemia

Check if the same lab product or an alternative is used in the 5 most similar protocols
After an overnight fast, the rats were anesthetized with an intraperitoneal injection of 10% chloral hydrate (300 mg/kg). A burr hole for ICV administration was carefully made in the skull at 0.8 mm dorsal and 1.6 mm lateral to the right from the bregma using a dremel drill. Total 10 µl apelin-13 (0.03 µg/µl), 10 µl apelin-36 (0.05 µg/µl) (Phoenix Pharmaceuticals, Belmont, CA, USA) (dissolved in aseptic PBS) or 10 µl vehicle only (PBS) were administered into the right lateral ventricle 2 h after MCAO, using a 10 µl microsyringe at the following stereotactic coordinates (AP: −0.8 mm; ML: 1.6 mm; DV: −3.8 mm) as we described previously (16 (link), 17 (link)). The experiments were not performed in a blinded manner.
+ Open protocol
+ Expand
3

Apelin-36 Attenuates LPS-Induced Inflammation

Check if the same lab product or an alternative is used in the 5 most similar protocols
A total of 25 male Sprague-Dawley rats (age, 7–8 weeks) weighing 250–300 g were purchased from the Nanjing Jiancheng Bioengineering Institute. All animals were kept in a specific pathogen-free environment at 25°C under a controlled 12/12 h light/dark cycle, and all rats received food and water ad libitum. All experimental procedures were carried out in accordance with the US National Institutes of Health Guidelines for the Care and Use of Laboratory Animals, and were approved by the Ethical Committee on Animal Research at People's Hospital of Ningxia Hui Autonomous Region (approval no. IACUC-20191002-10; Yinchuan, China).
LPS was also obtained from Nanjing Jiancheng Bioengineering Institute. Apelin-36 was purchased from Phoenix Pharmaceuticals, Inc. The Apelin-36 kit (cat. no. kt98790) was provided by MSK Biotechnology Co., Ltd., whereas the ELISA kits and antibodies were obtained from Abcam.
+ Open protocol
+ Expand
4

Cyclic Peptide and Apelin Synthesis

Check if the same lab product or an alternative is used in the 5 most similar protocols
MM54 (cyclo[1-6]CRPRLCKHcyclo[9-14]CRPRLC) and MM193 were prepared as previously described (Macaluso et al., 2011 (link)). Temozolomide (TMZ) and tideglusib were purchased from Sigma, and apelin peptides were from Phoenix Pharmaceuticals (pyr1-apelin-13 pyr1-QRPRLSHKGPMPF, apelin-13 QRPRLSHKGPMPF, and apelin-36 LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF).
+ Open protocol
+ Expand
5

Apelin and Elabela Peptide Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols
Human Apelin-13, pGlu1-Apelin-13, Apelin-17, Apelin-36, Elabela-21, and Elabela-32 peptides were obtained from Phoenix Pharmaceuticals (Belmont, CA, United States). [125I]-Apelin-13 was purchased from Perkin Elmer (Wellesley, MA, United States).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!