Nf023

Manufactured by Bio-Techne

Sourced in United Kingdom, United States

NF023 is a laboratory instrument designed for the analysis of biological samples. It is capable of performing various assays and measurements related to cellular and molecular biology. The core function of NF023 is to facilitate research and scientific investigations in the life sciences field.

Automatically generated - may contain errors

Lab products found in correlation

5 protocols using nf023

Antagonists of P2 Purinergic Receptors

Check if the same lab product or an alternative is used in the 5 most similar protocols

P2 receptor antagonists: Pyridoxal phosphate-6-azo (benzene-2,4-disulfonic acid) tetrasodium salt hydrate (PPADS), MRS2211, MRS2179, MRS2159, A438079, Brilliant Blue G, ATP-2′, 3′-dialdehyde (OxATP), niflumix acid, carbenoxolone disodium salt, and apyrase were purchased from Sigma-Aldrich (St. Louis, MO, United States). NF449, NF023, and Evans Blue tetrasodium salt were purchased from Tocris Bioscience (Abingdon, United Kingdom). Suramin hexasodium salt was purchased from Aladdin (Shanghai, China). Anti-His monoclonal antibody was purchased from EARTHOX Life Sciences (Millbrae, CA, United States). Anti-ETX monoclonal antibody was developed previously by colleagues in our laboratory. HRP-coupled goat anti-mouse IgG antibody was purchased from TransGen Biotech (Beijing, China). The ATP assay kit was purchased from Calbiochem-Merck (Darmstadt, Germany). MTS (3-(4, 5-dimethylthiazol-2-yl) -5(3-carboxymethoxyphenyl) -2-(4-sulfopheny)-2H-tetrazolium, inner salt) was purchased from Promega Corporation (Madison, WI, United States).

Gao J., Xin W., Huang J., Ji B., Gao S., Chen L., Kang L., Yang H., Shen X., Zhao B, & Wang J. (2018). Hemolysis in human erythrocytes by Clostridium perfringens epsilon toxin requires activation of P2 receptors. Virulence, 9(1), 1601-1614.

+ Open protocol

+ Expand

Suramin and Fondaparinux Sodium Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols

Suramin hexasodium salt, NF023, NF110, NF157, NF279, NF340, NF449, PSB0739, and MRS2578 were purchased from Tocris Bioscience. Fondaparinux sodium (Arixtra) was purchased from GlaxoSmithKline. Pirodavir was a kind gift from Dr. John Lambert, Biota Pharmaceuticals. MRS2578 and Pirodavir were dissolved in DMSO and used for the experiments.

Nishimura Y., McLaughlin N.P., Pan J., Goldstein S., Hafenstein S., Shimizu H., Winkler J.D, & Bergelson J.M. (2015). The Suramin Derivative NF449 Interacts with the 5-fold Vertex of the Enterovirus A71 Capsid to Prevent Virus Attachment to PSGL-1 and Heparan Sulfate. PLoS Pathogens, 11(10), e1005184.

+ Open protocol

+ Expand

Lipopolysaccharide Stimulation Assays

Check if the same lab product or an alternative is used in the 5 most similar protocols

Lipopolysaccharide (LPS) from Escherichia coli(E. coli) O111:B4 was used for all experiments
(Sigma-Aldrich, St. Louis, MO). A highly purified (by gel-filtration
chromatography; Sigma product number L3012) was used for in
vitro experiments. For in vivo experiments, we
used endotoxin from E. coli O111:B4 that was purified by phenol
extraction (Sigma product number L2630). Apyrase was obtained from Sigma-Aldrich
as a lyophilized powder, which we reconstituted in Hanks’ balanced salt
solution (HBSS; HyClone, Thermo Fisher Scientific, Waltham, MA). E.
coli (strain DH5-α), Rhod-2 AM and Fluo-4 AM were purchased
from Thermo Fisher Scientific (Waltham, MA). NF023 was from Tocris Bioscience
(R&D Systems, Minneapolis, MI); N-formylmethionine-leucyl-phenylalanine
(fMLF; also known as fMLP) and all other reagents were obtained from
Sigma-Aldrich and of tissue culture grade unless otherwise stated.

Kondo Y., Ledderose C., Slubowski C.J., Fakhari M., Sumi Y., Sueyoshi K., Bezler A.K., Aytan D., Arbab M, & Junger W.G. (2019). E. coli use LPS as decoy to impair neutrophil chemotaxis and defeat antimicrobial host defense. Journal of leukocyte biology, 106(6), 1211-1219.

+ Open protocol

+ Expand

Pharmacological Characterization of 5-HT Receptors

Check if the same lab product or an alternative is used in the 5 most similar protocols

5-Hydroxytryptamine hydrochloride (serotonin hydrochloride; 5-HT), GTPγS, and PTX were purchased from Sigma-Aldrich. (1R,4R,5S,6R)-4-Amino-2-oxabicyclo[3.1.0]hexane-4,6-dicarboxylic acid (LY379268), (2S)-2-amino-2-[(1S,2S)-2-carboxycycloprop-1-yl]-3-(xanth-9-yl) propanoic acid (LY341495), methysergide, l-glutamic acid, U73122, and NF023 were obtained from Tocris Bioscience. (1R,4S,5S,6S)-4-[[(2S)-2-Amino-4-(methylthio)-1-oxobutyl]amino]-2-thiabicyclo[3.1.0]hexane-4,6-dicarboxylic acid 2,2-dioxide (LY404039) was obtained from Selleckchem. The Gβγ-blocking peptide (MPS phosducin-like protein C-terminus: AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE) was obtained from AnaSpec. UBO-QIC (also known as FR900359) was purchased from the Institute of Pharmaceutical Biology, University of Bonn. M100,907 (volinanserin) was obtained from Sanofi. [³H]Ketanserin and [³⁵S]GTPγS were obtained from PerkinElmer Life and Analytical Sciences Inc. [H]LY341495 was purchased from American Radiolabeled Chemicals Inc. All other chemicals were obtained from standard sources.

Moreno J.L., Miranda-Azpiazu P., García-Bea A., Younkin J., Cui M., Kozlenkov A., Ben-Ezra A., Voloudakis G., Fakira A.K., Baki L., Ge Y., Georgakopoulos A., Morón J.A., Milligan G., López-Giménez J.F., Robakis N.K., Logothetis D.E., Meana J.J, & González-Maeso J. (2016). Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia. Science signaling, 9(410), ra5.

+ Open protocol

+ Expand

Molecular Mechanisms of LPA-Induced Inflammatory Responses

Check if the same lab product or an alternative is used in the 5 most similar protocols

FBS was obtained from HyClone (Logan, UT, USA). LPS, LPA, pertussis toxin (PTX) and Griess reagent were from Sigma (St. Louis, MO, USA). Reverse transcriptase and Taq polymerase were from Promega (Madison, WI, USA). The selective Ga i/o inhibitor NF023 was from TOCRIS Bioscience (Minneapolis, MN, USA). The pan-LPA receptor antagonist BrP-LPA
(1-bromo-3-(S)-hydroxy-4-[palmitoyloxy]butyl phosphonate) was purchased from Echelon Biosciences Inc. (Salt Lake, UT, USA). Rabbit anti-COX-2 polyclonal Ab and rabbit anti-iNOS polyclonal Ab were from Santa Cruz Biotechnology (Dallas, TX, USA). PhosphoPlus Ab kits for MAPKs p38 (Thr180/Try182), JNK (Thr183/Try185) and ERK p44/p42 (Thr202/Try204), as well as for Akt (Ser473), were from Cell Signaling (Danvers, MA, USA). Rabbit anti-NF-jB/p65 (RelA) polyclonal Ab was from Thermo Fisher Scientific (Fremont, CA, USA). Mouse anti-a-tubulin monoclonal Ab and sheep antimouse IgG secondary Ab conjugated with HRP were from Sigma. Mouse anti-histone H1 monoclonal Ab was purchased from Santa Cruz Biotechnology. Donkey anti-rabbit IgG secondary Ab conjugated with HRP was from Amersham Life Science (Arlington Heights, IL, USA). PGE 2 enzyme immunoassay kit was from Assay Designs (Ann Arbor, MI, USA). Unless otherwise specified, all other chemicals and reagents used in this study were from Sigma.

Chien H.Y., Lu C.S., Chuang K.H., Kao P.H, & Wu Y.L. (2015). Attenuation of LPS-induced cyclooxygenase-2 and inducible NO synthase expression by lysophosphatidic acid in macrophages. Innate immunity, 21(6).

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!