The largest database of trusted experimental protocols

4 protocols using imidazole

1

Protein expression and purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Isopropyl β-d-1-thiogalactopyranoside (IPTG) was bought from INDOFINE Chemical Company Inc. (Hillsborough, NJ, USA). Sodium phosphate monobasic, sodium chloride, imidazole, Tris, HEPES and DMSO were all provided by VWR (Radnor, PA, USA). NTCB was purchased from TCI America (Portland, OR, USA). TCEP was obtained from Alfa Aesar (Tewksbury, MA, USA). LC/MS-grade water and acetonitrile for liquid chromatography were both purchased from Fisher Scientific (Waltham, MA, USA) and supplied with 0.1% Optima™ LC/MS-grade formic acid (Fisher Scientific, Waltham, MA, USA). All oligonucleotide primers and DNA sequences used for DNA mutagenesis were synthesized by Integrated DNA Technologies (Coralville, IA, USA). Sanger sequencing was performed by Eton Bioscience Inc. (San Diego, CA, USA).
+ Open protocol
+ Expand
2

Ddx4n1 Droplet Partitioning Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols
pET30M-2 plasmids encoding His_tag-GST-TEV_site-Ddx4n1 or His_tag-GST-TEV_site-Ddx4n1-YFP (see sequence details below) were kind gifts from Dr. Tim Nott (Oxford University). ampicillin resistant TEV plasmid encoding MBP–TEV_site–His-tag–S-TEV was a kind gift from Charlotte O’Shea (University of Copenhagen). All constructs where sequenced by GATC (Eurofins, Germany) in order to ensure no point mutations had occurred. Tris, TCEP, NaCl, CaCl2, PEG3000, PEG6000, Imidazole, LB broth, benzonase, ampicillin, kanamycin and reduced glutathione were all purchased from VWR (Denmark). The ssDNA as previously described to be partitioned by Ddx4n1 droplets by Nott et al.35 (link) with the sequence 5'-TTT TTC CTA GAG AGT AGA GCC TGC TTC GTG G-3' as well as the 5'Alexa-488 labeled version was synthesized, HPLC purified and lyophilized by TAG Copenhagen (Denmark). The RP3 peptide was synthesized and HPLC purified by Bachem (Switzerland) and delivered as TFA salt after MALDI-MS quality control. Fluoresbrite YG Microspheres of calibration grade were purchased from Polysciences Europe GmbH (Germany). All other relevant salts, buffer components and materials were purchased from Sigma (USA) & VWR (Denmark) and dissolved in RNAse and nuclease free milliQ water unless otherwise specified.
+ Open protocol
+ Expand
3

Intranasal Immunomodulation in Tuberculosis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Mice were infected with ~100 CFU of Mtb H37Rv in an aerosol exposure chamber as outlined above. Next day, the infected mice were intranasally treated with ornithine (L-ornithine monohydrochloride; KYOWA HAKKO BIO Co., Ltd.) and imidazole (Sigma-Aldrich) at varying concentrations. In brief, mice were deeply anesthetized with ketamine plus xylazine (75 and 10 mg/kg i.p. injections) followed by intranasal administration of L-ornithine monohydrochloride (1000 mg/kg, 2500 mg/kg, or 5000 mg/kg) and imidazole (100 mg/kg, 300 mg/kg, or 600 mg/kg) twice a week for 30 days, while the control mice were injected with PBS (pharmaceutical grade; VWR life science). The highest dose was selected based on the LD50 provided in the manufacturer’s safety data sheet. After 30 days of treatment, the lungs were harvested to examine the CFU counts. In brief, the lungs were placed into 30-mm dishes containing 2 ml of 7H9 media and minced with scissors into pieces no larger than 2–3 mm. The fluid was discharged through a 70-μm filter (BD Biosciences, San Jose, CA) suspended over a 50-ml conical tube. The syringe plunger was then used to gently disrupt the lung tissue and the supernatant containing the cells was incubated for 2 h at room temperature. Finally, CFU assay was performed as outlined above. All the experiments were performed thrice with five mice in each group.
+ Open protocol
+ Expand
4

Synthesis and Purification of ATG16L1

Check if the same lab product or an alternative is used in the 5 most similar protocols
The labeled, Rho-ATG16L1-N (TAMRA-PRWKRHISEQL RRRDRLQRQAFEEIILQYNKLL), and unlabeled, AT G16L1-N (PRWKRHISEQLRRRDRLQRQAFEEIILQYN KLL), α-helical segment of ATG16L1 (residues 11-43) was purchased through the University of Illinois at Chicago (UIC) Research Resources Center (RRC, Chicago, IL); the labeled peptide is tagged with 5,6-carboxytetramethylrhodamine on the N-terminus of the α helix (no linker), and the final product was obtained in ≥90% purity. 10 Isopropyl-β-D-thiogalactoside (IPTG; cat. no. I6758, Sigma-Aldrich, St. Louis, MO), Na 2 PO 4 (cat. no. BP331, Thermo Fisher Scientific, Waltham, MA), NaCl (cat. no. 0241, VWR, Radnor, PA), imidazole (cat. no. I2399, Sigma-Aldrich), 2-mercaptoethanol (cat. no. O3446I, Thermo Fisher Scientific), phenylmethanesulfonyl fluoride (PMSF; cat. no. P7626, Sigma-Aldrich), Triton X-100 (cat. no. 0694, VWR), 1× phosphate-buffered saline (PBS; cat. no. 21-040-CM, Corning, Corning, NY), DMSO (cat. no. 25-950-CQC, Corning), and Tween 20 (cat. no. M147, Amresco, Solon, OH) were also used.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!