Synthetic beta-amyloid peptide 42 carrying the E674Q mutation (DAQFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) and the wild-type beta-amyloid peptide 42 (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) were purchased from QYAOBIO, China. The freshly prepared Aβ42 peptides of wild type and E674Q Aβ42 peptides were aggregated in HEPES buffer. Ten microliters of these solutions were added to carbon-coated, 100-mesh copper grids (Electron Microscopy Sciences, Hatfield, PA). The extra water was blotted with tissue paper after 2–3 min, and a few mild washings were performed with Milli-Q water (Millipore, Billerica, MA). A quantity of 0.1% of uranyl acetate was added for 5 min for sample staining. The grids were dried under an infrared lamp and examined with a LIBRA 120 EFTEM (Carl Zeiss, Oberkochen, Germany).17 (link)
Libra 120 eftem
Manufactured by Zeiss
Sourced in Germany
The Libra 120 EFTEM is an energy-filtering transmission electron microscope (EFTEM) manufactured by Zeiss. It is designed to provide high-resolution imaging and spectroscopic analysis of samples at the nanoscale level. The Libra 120 EFTEM utilizes an electron beam to generate and transmit electrons through thin specimens, allowing for the observation and analysis of their internal structure and chemical composition.
Automatically generated - may contain errors
Lab products found in correlation
Ft ir prestige 21 spectrophotometer, by Shimadzu (2 mentions)
Milli q water, by Merck Group (1 mentions)
Osmium tetraoxide, by Ted Pella (1 mentions)
Air mp microscope, by Nikon (1 mentions)
Glutaraldehyde, by Merck Group (1 mentions)
Lead citrate, by Merck Group (1 mentions)
Toluidine blue, by Merck Group (1 mentions)
Uranyl acetate, by Merck Group (1 mentions)
Fei quanta 650 feg, by Thermo Fisher Scientific (1 mentions)
Evo ma10, by Zeiss (1 mentions)
D8 advance x ray diffractometer, by Bruker (1 mentions)
Em uc6 ultramicrotome, by Leica (1 mentions)
16 protocols using libra 120 eftem
1
Visualizing Amyloid-Beta Peptide Aggregation
2
Centrosome Amplification and Organization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
To study centrosome amplification and organization in higher magnification 14-3-3γ-knockdown and vector-control cells were visualized under transmission electron microscope. Synchronized cells in S-phase were fixed with 3% glutaraldehyde, washed with 0.1 M of sodium cacodylate and post fixed with 1% osmium tetra oxide (Tedpella). Cultures were dehydrated and processed. Grids were contrasted with alcoholic uranyl acetate for 1 minute and lead citrate for half a minute. The grids were observed under a Carl Zeiss LIBRA120 EFTEM transmission electron microscope, at an accelerating voltage of 120KV and at 25000X magnification. Images were captured using a Slow Scan CCD camera (TRS, Germany).
3
Phage Morphology Visualization by TEM
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Purified phage sample was loaded onto a copper grid for 1 min followed by negative staining with 2% (vol/vol) uranyl acetate (pH 6.7) and drying. The phage morphology was observed using a Carl Zeiss LIBRA 120 EF-TEM (Carl Zeiss, Oberkochen, Germany) at an accelerating voltage of 120 kV.
4
Multimodal Microscopy Characterization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Scanning electron microscopy and electron microprobe (EDS) analysis were performed with a Zeiss Merlin field-emission SEM instrument. Transmission electron microscopy images were collected with a Zeiss Libra 120 EFTEM. Confocal laser scanning microscopy (CLSM) imaging of bacterial biofilms was performed with a Nikon AIR MP microscope equipped with a 60×, NA 1.4, oil immersion phase-contrast objective (excitation wavelength 488 nm).
5
Electron Microscopy of Epon Sections
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
For electron microscopy, epon blocks were sectioned to 80 nm sections. Electron microscopy was performed using a Zeiss® Libra 120 EFTEM (ZEISS, Oberkochen, Germany) as described in Pritz et al. (2013a (link)) and Thaler et al. (2011 (link)).
6
Ultrastructural Analysis of MCF7 Cells
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Parental MCF7 and MCF7-RR cell pellets were fixed with 3% glutaraldehyde. Post-fixation was performed with 1% osmium tetraoxide. Alcoholic uranyl acetate treatment for 1 min and lead citrate treatment for 30 s was done for grid contrasting and then observed under Carl Zeiss LIBRA120 EFTEM.
7
Cally2R Treatment Imaging Protocol
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Cells were treated with Cally2R for the indicated time. Cells were then fixed with 2.5% glutaraldehyde (Sigma) in 0.1 M phosphate (pH 7.4). The samples were placed on grids and subsequently captured results using a LIBRA 120 EF-TEM (Carl Zeiss) with the help from SNU to prepare the samples for TEM imaging at the SNU microscopy facility.
8
Elemental Analysis of Proteins and Glycoproteins
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Electron energy loss spectroscopy (EELS) and electron spectroscopic imaging (ESI) were used for element analysis with a Zeiss Libra 120 EFTEM (Zeiss, Oberkochen, Germany). Nitrogen (N), as a leading element of proteins and glycoproteins, was measured spectroscopically with parallel EELS by using its energy loss at 397 eV at the N-K edge. ESI was performed using a three-window method and the ImageSP software. A high contrast image made at 250 eV was inverted, combined with the maximum element distribution, and mix-mapped with false colours.
9
Comprehensive Characterization of hSPION-Au Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
To characterise the morphology of hSPION-Au, transmission electron microscopy (TEM) was performed using a Carl Zeiss EF-TEM LIBRA 120 (Oberkochen, Germany). The samples were placed on a copper grid for TEM measurements. Furthermore, the magnetisation of the particles was assessed using a vibrating sample VSM-7410 magnetometer (Lake Shore, OH, USA) at room temperature within the range of −150 to +150 emu/g. Dynamic light scattering and electrophoretic light scattering (DLS/ELS) were measured using a Malvern Zetasizer Nano ZSU5800 (Malvern, UK) to evaluate the size distribution and zeta potential. Then, we used a NanoSight NS300 (Malvern, UK) to assess the particle size distributions and concentrations. All samples were diluted to appropriate volumes with phosphate-buffered saline (PBS). Tracking videos were recorded in triplicate for 30 s each and analysed using NTA software (version 2.3; NanoSight, Malvern, UK).
10
Ultrastructural Analysis of MCF-7 Cells
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
MCF-7 cells were treated for 24 h with EHX or absolute ethanol. Cells were fixed with 0.1 M McDowell–Trump and stained with osmium tetroxide (1%). The cells were then solidified in agar (2%), cut into small slides, and dehydrated in ethanol followed by acetone. The slides were embedded in resin and infiltrated for five days in Suprr's mixture at 60°C and changed repeatedly every day. Subsequently, the strips were molded in resin molds and sliced into 0.1 μm thickness. The ultrathin sections were stained with toluidine blue (Sigma-Aldrich, USA) and collected in copper grids. Consequently, it was doubly stained with uranyl acetate and lead citrate (Sigma-Aldrich, USA) [24 (link)]. Finally, the cells were photographed using TEM (EFTEM Libra 120, Carl-Zeiss, Germany) at 1250x magnification.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!