Cytochrome c

The fluorescence spectra were acquired on a SPEX Fluorolog 3-TCSPC spectrometer equipped with 1 cm path length cuvettes. The pH value was measured by PHS-3C Precision Ph/Mv Meter. The cell images were acquired on an Olympus Biological Microscope System. The 3 peptides, TAM-PEP (R4): TAM-RRRRNLWAAQRYGRELRRMSDKFVD, TAM-PEP (R6): TAM-RRRRRRNLWAAQRYG RELRRMSDKFVD and TAM-PEP (R8): TAM-RRRRRRRRNLWAAQRYGRELRRMSDKFVD, were synthesized by GL Biochem (Shanghai, China) Ltd. GO (XF-020, 50–200 nm) was purchased from XianFeng Nano Co. (Nanjing, China). The cDNA3.1-Bcl-xL plasmid was constructed by Genecreate Biological Engineering Co. (Wuhan, China) Tris-HCl, IPTG, PMSF, Anti-Bcl-xL antibody, Anti-ACTB antibody, HRP-conjugated Goat Anti-Rabbit IgG, Cell Counting Kit-8, Cytochrome C, BSA, RNase and lysozyme were purchased from Sangon Biotechnology Co. (Shanghai, China) BeyoECL Star and trypsin digestion solution were purchased from Beyotime Biotechnology Co. (Shanghai, China) Lipo ™ 2000 was purchased from Thermo Fisher Scientific Co.(Beijing, China)The deionized water was prepared on a Milli-Q water purification system and used throughout all experiments.

Tannic acid, PEG10k, F-68, KO₂, α-amylase, xanthine oxidase, BSA, fluorescein 5(6)-isothiocyanate, pepsin (from porcine gastric mucosa) and pancreatin (from porcine pancreas) were bought from Sigma-Aldrich. DSPE-PEG2k was obtained from Advanced Vehicle Technology Pharmaceutical Co., Ltd (Shanghai, China). Cy5.5-NHS were purchased from (ApexBio Technology, USA). Cytochrome C was obtained from Sangon Biotech (Shanghai, China). Infliximab was purchased from BioChemPartner (Shanghai, China). Dextran sodium sulfate (molecular weight: 36,000-50,000 Da) were purchased from MP Biomedicals Inc. (USA).