PT-peptide (LDHVCNFRVMPRLRSWELYFRGDVWCPGWTVIKG) and FITC-labeled PT-peptide (labeled on N-terminal) were synthesized from LTK BioLaboratories Inc. (Tauyuan, Taiwan). Trypan blue, RPMI 1640 medium, L-glutamine, and sodium pyruvate were purchased from GIBCO (Grand Island, NY, USA). Dichloro-dihydro-fluorescein diacetate (DCFH-DA) and RIPA lysis buffer were purchased from Sigma Chemical Co. (St. Louis, MO, USA). Potassium dihydrogen phosphate (KH2PO4) and dipotassium hydrogen phosphate (K2HPO4) were purchased from Merck Co. Ltd.(Darmstadt, Germany). Fetal bovine serum (FBS) was purchased from Hyclone (Logan, UT, USA). GPADH antibody [ab8245] and CD11b antibody [ab133357] were purchased from Abcam (Cambridge, MA, USA).
Cd11b antibody ab133357
Manufactured by Abcam
Sourced in United States
The CD11b antibody [ab133357] is a mouse monoclonal antibody that recognizes the CD11b antigen. CD11b is a cell surface glycoprotein that is expressed on the surface of myeloid cells, including monocytes, macrophages, and granulocytes. The antibody can be used for the identification and characterization of CD11b-positive cells in various applications.
Automatically generated - may contain errors
Lab products found in correlation
Rpmi 1640 medium, by Thermo Fisher Scientific (1 mentions)
Sodium pyruvate, by Thermo Fisher Scientific (1 mentions)
L glutamine, by Thermo Fisher Scientific (1 mentions)
Trypan blue, by Thermo Fisher Scientific (1 mentions)
Ripa lysis buffer, by Merck Group (1 mentions)
Dipotassium hydrogen phosphate k2hpo4, by Merck Group (1 mentions)
Potassium dihydrogen phosphate kh2po4, by Merck Group (1 mentions)
Dichloro dihydro fluorescein diacetate dcfh da, by Merck Group (1 mentions)
β actin sc 47778 antibody, by Santa Cruz Biotechnology (1 mentions)
Lpc 18 1, by Avanti Polar Lipids (1 mentions)
Apocynin, by Abcam (1 mentions)
2 protocols using cd11b antibody ab133357
1
Peptide-Mediated Fluorescent Assay
2
LPS-Induced Inflammation: Lipid Mediators Analysis
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
LPS (from E. coli O26 by phenol extraction) was purchased from FUJIFILM Wako (Tokyo, Japan) . LPC18:1 and LPE18:1 were purchased from Avanti Polar Lipids (Alabaster, AL, USA) . CD11b antibody (ab133357) and apocynin were purchased from Abcam (Cambridge, MA, USA) . Iba1 antibody (MABN92) was purchased from Sigma-Aldrich (St. Louis, MO, USA) . β-actin (sc-47778) antibody was purchased from Santa Cruz Biotechnology (Santa Cruz, CA, USA) .
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!