Pep 1

Anti-IL-13Rα2 (sc-134363) mouse monoclonal was obtained from Santa Cruz Biotechnology (Dallas, TX, USA). Horseradish peroxidase (HRP)-conjugated secondary antibodies and enhanced chemiluminescence (ECL) advanced reagent were from Cytiva (Little Chalfont, UK). Pep-1 (CGEMGWVRC), Phor21 (KFAKFAKKFAKFAKKFAKFAK), Pep-1-Phor21 (CGEMGWVRCKFAKFAKKFAKFAKKFAKFAK) and Phor21-βCG(ala) (KFAKFAKKFAKFAKKFAKFAKSYAVALSAQAALARR) were synthesised by Thermo Fisher Scientific (Loughborough, UK). AlamarBlue was obtained from Thermo Fisher Scientific (Loughborough, UK). CellTox Green and ApoTox-Glo Triplex assay kits were purchased from Promega (Southampton, UK). The pharmacological inhibitors TSA, 5-AZA and an anti-α tubulin mouse monoclonal were from Merck (Gillingham, UK). JetPRIME transfection reagent was obtained from Polyplus-transfection (Illkirch, France). All other reagents, unless otherwise specified, were obtained from Merck (Gillingham, UK).

Pep-1-Phor21 (ACGEMGWVRCGGGKFAKFAKKFAKFAKKFAKFAK) and its individual subunit motifs, Pep-1 (ACGEMGWVRCGGGS) and Phor21 (KFAKFAKKFAKFAKKFAKFAK), were synthesized (>95% purity) by Thermo Fisher Scientific Inc. Phor21-βCG [30 (link)] was used where indicated. Epigenetically active inhibitor compounds Trichostatin-A (TSA (#T8552)) and 5-aza-2′-deoxycytidine (5-aza-dC (#A3656)) were obtained from Merck.