Chemstrip 2gp

Manufactured by Roche

Sourced in Switzerland

The Chemstrip 2GP is a laboratory strip used for the rapid and semi-quantitative determination of glucose and protein in urine samples. It provides a simple, efficient, and cost-effective way to screen for these analytes in a clinical setting.

Automatically generated - may contain errors

Lab products found in correlation

Alzet osmotic pump, by Durect (2 mentions) Prism 5, by GraphPad (1 mentions) Vetscan vs2, by Abaxis (1 mentions) Vetscan hm5, by Abaxis (1 mentions) Ultra sensitive mouse insulin elisa kit, by Crystal Chem (1 mentions) Alphatrak, by Abbott (1 mentions) Mrl lpr mice, by Jackson ImmunoResearch (1 mentions)

Spelling variants of this product

Chemstrips (8 citations)

9 protocols using chemstrip 2gp

Hematology and Chemistry Analysis in Humanized Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols

Complete blood count (CBC) was analyzed with the Abaxis VetScan HM5 hematology machine. Blood was collected in potassium EDTA microtainer tubes (BD 365973) via cheek bleed or heart puncture. Approximately 20–30 μl of blood was used and kept at room temperature for less than 2 h to avoid hemolysis.
Chemistry analysis was measured with the Abaxis VetScan VS2 chemistry machine. The comprehensive panel (DVM Resources 106144) includes albumin (ALB), alkaline phosphatase (ALP), alanine transaminase (ALT), amylase (AMY), total bilirubin (TBil), blood urea nitrogen (BUN), calcium (CA+), phosphate (PHOS), creatine (CRE), Glucose, NA+, K+, total protein (TP), and globulin (Glob). Approximately 100 μl of blood was collected via cheek bleed or heart puncture in lithium heparin tubes (BD 365965). Samples were kept and read at room temperature up to 4 h to avoid hemolysis. Urine glucose and protein analysis was done with Chemstrip 2 GP (Roche-Cobas; #11895397160). Statistical analysis for CBC and blood chemistry was done by one-way ANOVA Bartlett's test for equal variances and Tukey's Multiple Comparison Test. Pearson's correlation and Mann–Whitney test were applied for analysis of humanized mice with different levels of reconstitution (GraphPad Prism 5).

Knibbe-Hollinger J.S., Fields N.R., Chaudoin T.R., Epstein A.A., Makarov E., Akhter S.P., Gorantla S., Bonasera S.J., Gendelman H.E, & Poluektova L.Y. (2015). Influence of age, irradiation and humanization on NSG mouse phenotypes. Biology Open, 4(10), 1243-1252.

+ Open protocol

+ Expand

Subcutaneous Implantation of S961 Peptide Pump

Check if the same lab product or an alternative is used in the 5 most similar protocols

The S961 peptide (sequence: GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY) was synthesized by LifeTein, LLC, with an intrachain disulphide bridge between Cys33 and Cys40 (underlined). S961 (20 nMol/week) or control PBS was filled into the Alzet osmotic pump (2001 model, Durect) and inserted subcutaneously at the back of anaesthetized mice through an incision between scapula. Blood glucose levels were monitored twice a day (Chemstrip 2GP; Roche); the mice with a level above 250 mg/dl for two consecutive measurements were considered diabetic.

Wan X., Zinselmeyer B.H., Zakharov P.N., Vomund A.N., Taniguchi R., Santambrogio L., Anderson M.S., Lichti C.F, & Unanue E.R. (2018). Pancreatic islets communicate with lymphoid tissues via exocytosis of insulin peptides. Nature, 560(7716), 107-111.

+ Open protocol

+ Expand

Subcutaneous Implantation of S961 Peptide Pump

Check if the same lab product or an alternative is used in the 5 most similar protocols

+ Open protocol

+ Expand

Adenovirus-Interferon-Alpha Murine Model

Check if the same lab product or an alternative is used in the 5 most similar protocols

All procedures were performed in accordance with federal, state and Institutional guidelines in an AAALAC-accredited facility and were approved by the MedImmune Institutional Animal Care and Use Committee.
On day 0, mice were injected intravenously (lateral tail vein) with 0.3 × 10¹⁰ viral particles of either Ad Null (empty vector control) or Adenovirus-interferon-alpha (Adv-IFN) in 0.1 M phosphate buffered saline (PBS) pH 7.2 (Gibco). Twice weekly dosing of MEDI-579 (1 mg/kg or 10 mg/kg; or antibody control, 10 mg/kg, intraperitoneally) began immediately following adenovirus delivery on day 0 and continued throughout the course of the study. Mice were placed in metabolic cages once weekly in order to collect 24 hour urine samples. These urine samples were frozen and sent to AniLytics (Gaithersburg, MD) for chemistry analysis; total protein, creatinine and sodium. For the single dose pharmacodynamic assessment, NZBxNZW/F1 mice that had a dipstick reading of greater than 1 + (Chemstrip 2 GP, Roche, Indianapolis IN) at four weeks post-Adv-IFN infection, received a single dose of MEDI-579 (10 mg/kg; or antibody control, 10 mg/kg, intraperitoneally). Mice were terminated 48 hours following administration and MEDI-579; active PAI-1 and active plasmin were measured in plasma.

Vousden K.A., Lundqvist T., Popovic B., Naiman B., Carruthers A.M., Newton P., Johnson D.J., Pomowski A., Wilkinson T., Dufner P., de Mendez I., Mallinder P.R., Murray C., Strain M., Connor J., Murray L.A., Sleeman M.A., Lowe D.C., Huntington J.A, & Vaughan T.J. (2019). Discovery and characterisation of an antibody that selectively modulates the inhibitory activity of plasminogen activator inhibitor-1. Scientific Reports, 9, 1605.

+ Open protocol

+ Expand

Glucose Tolerance Testing in PTP1B Knockout Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols

PTP1B^−/−and control mice were fasted 6 h. Intraperitoneal glucose tolerance testing was performed by injecting mice with D-glucose. Blood glucose concentrations were measured at 15, 30, 60, and 90 min post injection.⁷⁶ Blood glucose measurements were obtained using the AlphaTrak glucose monitoring system (Abbott Point of Care, Abbott Park, IL, USA). Urinary glucose measurements were assessed by dipstick urinalysis (Chemstrip 2 GP, Roche, Basel, Switzerland). Serum insulin concentrations were measured with the ultra-sensitive mouse insulin ELISA kit (Crystal Chem, Elk Grove Village, IL, USA).

Schwartz L., Salamon K., Simoni A., Eichler T., Jackson A.R., Murtha M., Becknell B., Kauffman A., Linn-Peirano S., Holdsworth N., Tyagi V., Tang H., Rust S., Cortado H., Zabbarova I., Kanai A, & Spencer J.D. (2024). Insulin receptor signaling engages bladder urothelial defenses that limit urinary tract infection. Cell reports, 43(4), 114007.

+ Open protocol

+ Expand

Measuring Proteinuria and Retinol in Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols

Proteinuria was measured weekly with Chemstrip 2GP (Roche, Indianapolis, IN). A scale of 0–4 was used that corresponded to negative, trace (5–20 mg/dL), 30 mg/dL, 100 mg/dL, and 500 mg/dL total protein, respectively. Dermatitis on the back of the neck and/or face of the mice was observed and recorded in a blinded fashion. Total retinol from liver samples was quantified by Ultra Performance Liquid Chromatography (UPLC) after extraction and saponification. Briefly, portions of each sample (around 0.05 g) were saponified in 5% potassium hydroxide, 1% pyrogallol and 98% ethanol, at 55°C. After extraction into hexanes and phase separation with water, an aliquot of the upper phase lipid extract was mixed with a known amount of internal standard, trimethylmethoxyphenyl-retinol (provided by M. Klaus, Hoffmann-La Roche, Basel, Switzerland). Samples were dried under nitrogen and reconstituted in methanol for UPLC analysis using a C-18 reversed-phase column and mobile phase of 92.5% methanol and 7.5% water at a flow rate of 0.6 ml/min with monitoring at 325 nm. The liver total retinol concentrations were calculated based on areas of the peaks for trimethylmethoxyphenyl-retinol (known amount) and total retinol.

Liao X., Ren J., Wei C.H., Ross A.C., Cecere T.E., Jortner B.S., Ahmed S.A, & Luo X.M. (2015). Paradoxical Effects of All-Trans-Retinoic Acid on Lupus-Like Disease in the MRL/lpr Mouse Model. PLoS ONE, 10(3), e0118176.

+ Open protocol

+ Expand

Diabetes Monitoring via Blood Glucose

Check if the same lab product or an alternative is used in the 5 most similar protocols

Blood glucose was monitored daily or weekly and after two consecutive readings of ≥250 mg/dL mice were considered diabetic (Chemstrip 2GP, Roche Diagnostics, Indianapolis, IN).

Ferris S.T., Carrero J.A., Mohan J.F., Calderon B., Murphy K.M, & Unanue E.R. (2014). A minor subset of Batf3-dependent antigen presenting cells in islets of Langerhans is essential for the development of autoimmune diabetes. Immunity, 41(4), 657-669.

+ Open protocol

+ Expand

LUpus Nephritis Treatment in MRL/lpr Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols

MRL/lpr mice were obtained from Jackson Laboratories (Stock No: 000485), and all in vivo studies were performed by Hooke Labs. All of the mice used in the experiments were kept under specific pathogen–free conditions. KD025 (100 mg/kg) was administered to mice orally once a day for 6 weeks beginning from 11 weeks of age. Mice (15 per group) were monitored weekly for proteinuria with Chemstrip 2GP (Roche # 200743). Scoring for proteinuria was performed as follows: 0, no protein; 1, protein of > 30 mg/dl; 2, protein of 30 to 100 mg/dl; 3, protein of 100 to 500 mg/dl; 4, protein > 500 mg/dl. The plasma concentrations of anti-dsDNA antibodies were measured with an anti-mouse dsDNA antibody ELISA kit (Biovendor #RSHAKRDD061R). Blood urea nitrogen was tested with a urease/Glutamate Dehydrogenase (GLDH) assay kit (Olympus Reagents) and was performed by IDEXX Laboratories. Histological and Flow analyses of kidneys and spleens were performed at the end of the treatment (week 17).

Weiss J.M., Chen W., Nyuydzefe M.S., Trzeciak A., Flynn R., Tonra J.R., Marusic S., Blazar B.R., Waksal S.D, & Zanin-Zhorov A. (2016). ROCK2 signaling is required to induce a subset of T follicular helper cells through opposing effects on STATs in autoimmune settings. Science signaling, 9(437), ra73.

+ Open protocol

+ Expand

Adoptive Transfer of Naive T Cells into NOD.Rag1-/- Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols

FACS-sorted naive T cells (CD4⁺CD8⁻B220⁻CD25⁻CD62L^hiCD44⁻) from 8F10.Rag1^−/− or BDC2.5 mice were transferred i.v. into 4–8-wk-old NOD.Rag1^−/− recipients (2 × 10⁵ per mouse). In some experiments, the T cells were cotransferred with 2 × 10⁶ FACS-sorted B cells (CD19⁺CD4⁻CD8⁻IgMa⁺GL7⁻IgG⁻) from V_H125^SD or WT NOD mice. Blood glucose was monitored daily or weekly (Chemstrip 2GP; Roche), and the mice were considered diabetic with a blood glucose level of ≥250 mg/dl for two consecutive measurements.

Wan X., Thomas J.W, & Unanue E.R. (2016). Class-switched anti-insulin antibodies originate from unconventional antigen presentation in multiple lymphoid sites. The Journal of Experimental Medicine, 213(6), 967-978.

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!