The largest database of trusted experimental protocols

18 protocols using mmp 13

1

Inhibition of MMP and ADAM Proteases

Check if the same lab product or an alternative is used in the 5 most similar protocols
KP‐457 and GM‐6001 were tested for their ability to inhibit MMP‐ and ADAM‐catalyzed cleavage of substrates in a fluorescence‐based assay. Human ADAM17, ADAM10, and MMP17 were from R&D Systems (Minneapolis, MN, http://www.rndsystems.com), and human MMP1, MMP2, MMP3, MMP8, MMP9, MMP13, and MMP14 were from EMD Millipore. MMP1, MMP2, MMP8, MMP9, MMP13, and MMP17 were activated using p‐aminophenylmercuric acetate (Sigma‐Aldrich) before testing. Fluorogenic substrates for measuring activity of ADAM10 and ADAM17 [Nma‐LAQAVRSSK(Dnp)r‐NH2, based on the cleavage site of TNF‐α]; MMP1, MMP9, MMP13, and MMP14 [Dnp‐P‐Cha‐GC(Me)HAK(N‐Me‐Abz)‐NH2]; MMP3 [MOCAc‐RPKPVE‐Nva‐WRK(Dnp)‐NH2]; and MMP2, MMP8, and MMP17 [MOCAc‐PLGL‐A2pr(Dnp)‐AR‐NH2] were all provided by Peptide Institute (Osaka, Japan, https://www.peptide.co.jp/en) and used as substrates. In addition, inhibitory activities were measured using LC/MS/MS with a GPIbα‐based substrate peptide (KKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDF), a C terminal‐based standard peptide (VLQGHLESSRNDPFLHPDF), and an internal standard peptide (VTTGKGQDHSPFWGF). These peptides were synthetized by Scrum (Tokyo, Japan, http://www.scrum‐net.co.jp/english/top_en.htm).
+ Open protocol
+ Expand
2

Chondrocyte Protein Expression Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Human articular chondrocyte cultures were extracted with RIPA lysis buffer containing protease inhibitors (Roche, West Sussex, United Kingdom). Proteins were resolved by 10% or 12% sodium dodecyl sulphate polyacrylamide gel electrophoresis and transferred to a polyvinylidene difluoride membrane (Millipore, Billerica, MA, USA). After being blocked with 5% non‐fat milk in Tris‐buffered saline–Tween buffer, the membrane was probed with primary antibodies specific for IL‐1β (Beyotime), p‐IKK‐α/β (CST), p‐P‐65 (CST), MMP13 (Millipore) and Aggrecan (Abcam) followed by secondary antibodies. The signal was detected with chemiluminescence (Pierce) according to the manufacturer's protocols. β‐actin (Sigma‐Aldrich) was applied to normalize the protein expression levels.
+ Open protocol
+ Expand
3

Ln-5 Proteolytic Cleavage by MMPs

Check if the same lab product or an alternative is used in the 5 most similar protocols
Purified Ln‐5 (100 ng; Abcam, ab42326) was treated with 50 nM human active recombinant MMP‐2 (Cat. No. PF023, Millipore, Darmstadt, Germany) or MMP‐13 (Cat. No. 44287, Millipore) and incubated in 50 mM Tris‐HCl (pH 7.5), 10 mM CaCl2, 150 mM NaCl, 1 mM ZnCl2 and 0.02% NaN3 for 6 hrs at 37°C. Then, all reactions were stopped with 5× denaturing buffer [0.15 M Tris (pH 6.7), 6% SDS, 20% glycerol, 0.1 M EDTA and 0.03% bromophenol blue]. The cleavage fragments were separated on SDS‐PAGE gels under reducing conditions and detected with silver staining, and then, the target band was extracted to detect the amino acid sequence using LC‐MS/MS.
+ Open protocol
+ Expand
4

Western Blot Analysis of Brain Proteins

Check if the same lab product or an alternative is used in the 5 most similar protocols
Proteins were isolated from the right hemisphere of P10 pup brains and Western blots were performed as previously described (Li et al., 2012b (link)). Briefly, samples with equal amounts of protein were loaded onto 10% polyacrylamide gel with 0.1% sodium dodecyl sulfate and separated by electrophoresis at 100 V for 120 minutes. Proteins were then transferred onto nitrocellulose membranes and probed with primary antibodies against HIF-1α (1:1000; Santa Cruz Biotechnology, Santa Cruz, CA), MMP-2 (1:1000), MMP-9 (1:1000) and MMP-13(1:500) (Millipore Corporation, Billerica, MA), respectively. After washing, membranes were incubated with secondary horseradish peroxidase conjugated antibodies. Proteins were visualized with enhanced chemiluminescence reagents, and blots were exposed to Hyperfilm. The results were analyzed with Kodak ID image analysis software. Band intensities were normalized to glyceraldehyde-3-phosphate dehydrogenase (GAPDH).
+ Open protocol
+ Expand
5

Chondrocyte Differentiation Pathway

Check if the same lab product or an alternative is used in the 5 most similar protocols
Antibodies used were phospho-PKCδ (Ser645), MMP-13, SOX-9, Collagen Type-X (Millipore, Billerica, MA), ADAMTS-5, (Thermo Fisher Scientific, Rockford, IL), RUNX-2, TIMP-3 (Abcam, Cambridge, MA), phospho-ERK1/2(Thr202/Tyr204), phospho-NF-κB-p65(Ser536) (Cell Signaling Technology, Danvers, MA).
+ Open protocol
+ Expand
6

Articular Chondrocyte Protein Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Human articular chondrocyte cultures were extracted using RIPA lysis buffer containing protease inhibitors (Roche). Protein was extracted from mouse whole joints following removal of the skin and muscle bulk. Tissue was snap-frozen and then extracted using RIPA lysis buffer. Equal amount of protein samples (30 μg) were dissolved by 12% sodium dodecyl sulfate–polyacrylamide electrophoresis gels and transferred onto a polyvinylidene difluoride membrane. After being blocked with 5% nonfat milk in Tris buffered saline–Tween buffer, the membrane was probed with primary antibodies specific for phosphorylated and total ERK1/2 (CST), p38 (CST), JNK (CST), MMP-13 (Millipore), ADAMTS-5 (Abcam), and phosphorylated and total FGFR1 (Santa) followed by secondary antibodies. The signal was detected using chemiluminescent (Pierce) according to the manufacturer’s instruction. The antibody specific for β-actin (Sigma) was applied to normalize the protein expression levels.
+ Open protocol
+ Expand
7

Protein Expression Analysis by SDS-PAGE and Western Blotting

Check if the same lab product or an alternative is used in the 5 most similar protocols
Protein was extracted using ice-cold RIPA lysis buffer containing protease inhibitors (Roche). Equal amount of protein samples (30 ug) were dissolved by 10% sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) gels and transferred onto a polyvinylidene difluoride membrane (Millipore). After being blocked with 8% nonfat milk in tris buffered saline tween buffer, the membrane was probed with antibody specific to ERK1/2 (1:1000 dilution; Cell Signaling Technology (CST)), p-ERK1/2 (1:1000 dilution; CST), MMP13 (1:1000 dilution; Millipore), Aggrecan (1:1000 dilution; Abcam) and b-Actin (1:10000 dilution; Sigma) followed by chemiluminescent (Pierce) detection. All antibodies were solvated with antibody diluent (Beyotime). Intensity values were analyzed with the Image J software and were normalized to those of b-Actin. Each sample was analyzed three times and the mean gray values of immunoblot band were calculated 20 .
+ Open protocol
+ Expand
8

Immunohistochemical Analysis of Chondrocyte Markers

Check if the same lab product or an alternative is used in the 5 most similar protocols
Histological sections (3 μm thick) were deparaffinized and rehydrated. Afterwards, sections were heated in a citrate buffer solution for antigen retrieval and incubated with methanol and a 6% hydrogen peroxide solution to quench the endogenous peroxidase activity. The sections were incubated with 1% BSA (bovine serum albumin; Sigma-Aldrich) for 45 min to block nonspecific reactions. The sections were incubated with the following primary antibodies at the indicated dilutions overnight at 4°C: 1:50 SOX-5 (H-90 Santa Cruz Biotechnology), 1:200 MMP-13 (SAB4501900 Sigma-Aldrich), 1:200 MMP-8 (SAB4501895 Sigma-Aldrich), 1:100 IHH (AV45230 Sigma-Aldrich), and 1:250 Col2 (M2139 Santa Cruz Biotechnology). The Advanced HRP system (Dako, Carpinteria, Calif., USA) was used to detect antibodies and specimens were counterstained with Mayer’s hematoxylin, dehydrated and mounted for observation and quantification [18 (link)].
Quantification was performed using WCIF ImageJ software. Three sections from each sample were selected, and the surface, middle, and deep sections were obtained, calibrated and color deconvolution was performed. In Vectors, H DAB was chosen and the brown image was selected. After many tests, the Threshold interval was selected (0 to 180) and the colored Area Fraction was obtained and compared to the total area of each studied section.
+ Open protocol
+ Expand
9

Chondrocyte Protein Expression Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
The chondrocytes and knee articular cartilage tissue were flushed three times with PBS and lysed using RIPA lysis buffer (Beyotime Biotechnology, Shanghai, China) for 30 min. The samples were separated by 10% sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and transferred to polyvinylidene fluoride (PVDF) membranes (Millipore, Billerica, MA). The membranes were blocked with 5% skim-milk powder for 30 min at room temperature and then incubated with the corresponding primary antibodies of NLRP3, ASC, caspase-1, IL-6, IL-18, TNF-α, MMP13, ADAMTS4/5, IGF-1, aggrecan and Col2a1 (1:1000, Sigma-Aldrich, St. Louis, MO) at 4 °C overnight. After washing with PBS, the membranes were incubated with horseradish peroxidase-labelled secondary antibody (1:2000, Cell Signaling Technology, Danvers, MA) for 1 h at room temperature. Ultimately, the intensity of protein expression was measured by an enhanced chemiluminescence reagent (Thermo Fisher Scientific, Carlsbad, CA). GAPDH served as control.
+ Open protocol
+ Expand
10

Liver Protein Expression Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Liver samples were homogenized with lysis buffer (Cell Signal Technology Inc., Danvers, MA) and centrifuged at 20,000 ×g for 60 minutes at 4°C. The resultant supernatants were used as the total liver protein and subjected to western blotting. The protein concentrations were determined by Bradford's method. Proteins were resolved by sodium dodecyl sulphate polyacrylamide gel electrophoresis and transferred to a polyvinyl difluoride membrane. Each blot was treated with the anti-b-actin antibody (β-actin 1 : 5,000; mouse monoclonal antibody; Sigma-Aldrich, St. Louis, MO), anti-matrix metalloproteinase-13 (MMP-13, 1 : 400), antitissue inhibitors of metalloproteinase-1 (TIMP-1, 1 : 400), anti-MMP-2 (1 : 300), and anti-TIMP-2 (1 : 400). All the above were from Santa Cruz Biotechnology. Then, secondary antibody (Santa Cruz Biotechnology) was added, and the reaction bands of western blot were quantified by Quantity One software (Bio-Rad Laboratories, Inc., Berkeley, CA) and modified by the β-actin. The values (% of control) are given as means ± SD of 5 animals.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!