1 1 dioctadecyl 3 3 3 3 tetramethylindotricarbocyanine iodide dir

Manufactured by Merck Group

Sourced in United States

1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR) is a fluorescent dye used in various laboratory applications. It has an absorption maximum at 748 nm and an emission maximum at 782 nm, making it suitable for near-infrared fluorescence imaging.

Automatically generated - may contain errors

Lab products found in correlation

Trypsin, by Beyotime (1 mentions) Phenylmethanesulfonyl fluoride pmsf, by Beyotime (1 mentions) Cell counting kit 8 cck 8, by MedChemExpress (1 mentions) Penicillin streptomycin solution, by Beyotime (1 mentions) Membrane protein extraction kit, by Beyotime (1 mentions) 3 4 5 dimethylthiazol 2 yl 2 5 diphenyltetrazolium bromide mtt, by Merck Group (1 mentions) Cd31 primary antibody, by Abcam (1 mentions) 4 6 diamidino 2 phenylindole (dapi), by Merck Group (1 mentions) Fitc annexin 5 apoptosis detection kit, by BD (1 mentions) Hoechst 33258, by Merck Group (1 mentions) Anti mouse pd 1 antibody clone rmp1 14, by BioXCell (1 mentions) Tryptone lp0042, by Thermo Fisher Scientific (1 mentions) 1 2 dioleoyl sn glycero 3 phosphate dopa, by Avanti Polar Lipids (1 mentions) Phosphatase inhibitor cocktail, by Merck Group (1 mentions) Yeast extract lp0021, by Thermo Fisher Scientific (1 mentions) 2 3 dioleoyloxy propyl trimethylammonium dotap, by Avanti Polar Lipids (1 mentions) Gemcitabine, by Eli Lilly (1 mentions) Cell counting kit 8 (cck8), by Dojindo Laboratories (1 mentions) Perfluoropentane, by Merck Group (1 mentions) Herceptin, by Roche (1 mentions)

Spelling variants of this product

1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (4 citations) DiR iodide (DiR) (2 citations)

5 protocols using 1 1 dioctadecyl 3 3 3 3 tetramethylindotricarbocyanine iodide dir

Polymeric Nanocarrier-Mediated Drug Delivery

Check if the same lab product or an alternative is used in the 5 most similar protocols

All reagents used in this work were of analytical grade. Citric acid, FeCl₃, and K₄[Fe(CN)₆] were purchased from Shanghai Jingchun Biological Technology Co., Ltd. (Shanghai, China). PLGA (lactide: glycolide = 50:50, PLGA 12,000 Da Mw) was obtained from Shandong Daigang Biology Engineer Corp. (China). Imiquimod (R837), docetaxel (DTX), Poly (vinyl alcohol) (PVA 25,000 Mw), calcein-AM (CAM), propidium iodide (PI), 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR) and fluorescence dyes 1,1′-dioctadecyl-3,3,3′,3′ tetra-methylindocarbocyanine perchlorate (DiI) were purchased from Sigma-Aldrich (Shanghai, China). Membrane protein extraction kits, phenylmethanesulfonyl fluoride (PMSF), penicillin–streptomycin solution, and trypsin were purchased from Beyotime (Shanghai, China). Trichloromethane (CHCl₃) was purchased from Chongqing Chuandong Chemical Corp. (Chongqing, China). Cell Counting Kit-8 (CCK-8) was obtained from MedChemExpress (Monmouth Junction, NJ, USA). Enzyme-linked immunosorbent assay (ELISA) kits including mouse IL-6, L-12, TNF-α and IL-10 were purchased from Meimian Industrial Co., Ltd. (Jiangsu, China).

Chen Q., Zhang L., Li L., Tan M., Liu W., Liu S., Xie Z., Zhang W., Wang Z., Cao Y., Shang T, & Ran H. (2021). Cancer cell membrane-coated nanoparticles for bimodal imaging-guided photothermal therapy and docetaxel-enhanced immunotherapy against cancer. Journal of Nanobiotechnology, 19, 449.

+ Open protocol

+ Expand

Carboplatin-Conjugated Nanoparticle Synthesis

Check if the same lab product or an alternative is used in the 5 most similar protocols

The carboplatin-conjugated R-carboxyl–poly(ethylene glycol)–poly(caprolactone) (CBP-PCL-PEG-COOH) was synthesized by Seebio Co., Ltd. (Shanghai, China). Etoposide and carboplatin were purchased from Xi’an Sanjiang Bio-Engineering Co. Ltd. (Xi’an, China). Functionalized TPP1 peptide with sequence of SGQYASYHCWCWRDPGRSGGSKPLGLAG-NH₂ was provided by GL Biochem (Shanghai, China). The Annexin V-FITC Apoptosis Detection kit was purchased from BD PharMingen (Heidelberg, Germany). The CD31 primary antibody and Alexa flour 488-labeled goat anti-rabbit secondary antibody were provided by Abcam (Cambridge, UK). 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR), 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide (MTT), and 4,6-diamidino-2-phenylindole (DAPI) were obtained from Sigma-Aldrich (St. Louis, MO). All the other chemical reagents and solvents were obtained from Sinopharm Chemical Reagent Co., Ltd. (Shanghai, China) unless specified otherwise.

Tao Z., Kuai X., Wang G., Liu S., Liu K., Zhang H., Xia S, & Zhu H. (2022). Combination of chemotherapy and immune checkpoint therapy by the immunoconjugates-based nanocomplexes synergistically improves therapeutic efficacy in SCLC. Drug Delivery, 29(1), 1571-1581.

+ Open protocol

+ Expand

Formulation and Characterization of DOTAP/DOPA Lipoplex

Check if the same lab product or an alternative is used in the 5 most similar protocols

(2,3-dioleoyloxy-propyl)-trimethylammonium (DOTAP) and 1,2-dioleoyl-sn-glycero-3-phosphate (DOPA) were obtained from Avanti Polar Lipids (Alabaster, AL, USA). 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol)-2000] (ammonium salt) (DSPE-PEG2000) was obtained from Xi’an Ruixi biotech (Xi’an, China). FHK peptide (FHKHKSPALSPV) was synthesized by China Peptides Co., Ltd (Shanghai, China). Low molecular weight protamine (LMWP), IGEPAL® CO-520, cholesterol, 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR), 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyl tetrazolium bromide (MTT), 4,6-Diamidino-2-phenylindole (DAPI), Hoechst 33258 and phosphatase inhibitor cocktails were provided by Sigma-Aldrich (St. Louis, MO, USA). α-M were purchased from Biopurify Co., Ltd (Chengdu, China). Collagenase type IV (40510ES60), hyaluronidase (20426ES60), DNase I (10608ES25) and Agar (70101ES76) were purchased from Shanghai yeasen biotech (Shanghai, China). Tryptone (LP0042) and Yeast extract (LP0021) were obtained from OXOID. Gemcitabine was obtained from Eli Lilly. Anti-mouse PD-1 antibody (clone: RMP1-14) and IgG isotype (MPC-11, BP0086) are acquired from BioXcell. All the other chemical reagents and solvents were acquired from Sinopharm Chemical Reagent Co., Ltd (Shanghai, China) unless specified.

Huang Y., Chen Y., Zhou S., Chen L., Wang J., Pei Y., Xu M., Feng J., Jiang T., Liang K., Liu S., Song Q., Jiang G., Gu X., Zhang Q., Gao X, & Chen J. (2020). Dual-mechanism based CTLs infiltration enhancement initiated by Nano-sapper potentiates immunotherapy against immune-excluded tumors. Nature Communications, 11, 622.

+ Open protocol

+ Expand

Multifunctional PLGA-PEG Nanocarriers

Check if the same lab product or an alternative is used in the 5 most similar protocols

PEGylated Poly (lactic-co-glycolic acid, lactide: glycolide = 50:50, PLGA 20,000 Da MW, PEG 10,000 Da MW) (PLGA-PEG_10,000) was purchased from the Shan-dong Key Laboratory of Medical Polymer Materials (Shan-dong, China). Oleic-acid-coated superparamagnetic iron oxide (SPIO) nanoparticles (d = 10 nm) were purchased from Ocean Nano Tech, Inc. (Arkansas, USA). Perfluoropentane (PFP, boiling point of 29 °C), fluorescence dyes (1,1'-dioctadecyl-3,3,3',3' tetramethylindocarbocyanine perchlorate (DiI), 3,3'-dioctadecyloxacarbocyanine perchlorate (DIO) and 1,1'-dioctadecyl-3,3,3',3'-tetramethylindotricarbocyanine iodide (DIR)) were obtained from Sigma-Aldrich (St. Louis, MO, USA). Herceptin was purchased from F. Hoffmann-La Roche. Cell Counting Kit-8 (CCK-8) was obtained from Dojindo Molecular Technologies (China). All chemicals used in this work were of analytical grade and were used as received.

Deng L., Cai X., Sheng D., Yang Y., Strohm E.M., Wang Z., Ran H., Wang D., Zheng Y., Li P., Shang T., Ling Y., Wang F, & Sun Y. (2017). A Laser-Activated Biocompatible Theranostic Nanoagent for Targeted Multimodal Imaging and Photothermal Therapy. Theranostics, 7(18), 4410-4423.

+ Open protocol

+ Expand

Multifunctional DNMF/PLGA Nanoparticles

Cited 1 time

Check if the same lab product or an alternative is used in the 5 most similar protocols

The materials used in this study included carboxyl-modified PEGylated poly (lactic-co-glycolic acid) (lactide: glycolide = 50:50, PLGA = 25,000 Da MW, PEG = 5000 Da MW; PLGA-PEG5000-COOH) and oleic acid-coated manganese ferrite (MnFe₂O₄) nanoparticles (NPs, particle size = 3 nm, concentration = 8 mg/mL), which were obtained from Ruixi Biotechnology (Xi’an, China). Doxorubicin (DOX) was purchased from Beyotime Biotechnology (Shanghai, China). L-arginine (L-Arg), 2,7-dichlorodihydrofluorescein diacetate (DCFH-DA), poly (vinyl alcohol) (PVA; MW = 25,000), 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR), and 2-(4-amidinophenyl)-6-indolecarbamidine dihydrochloride (DAPI) were obtained from Sigma-Aldrich (Missouri, USA). All reagents used in this study were of analytical grade.
Synthesis of DNMF/PLGA NPs: PLGA-PEG (50 mg), MnFe₂O₄ (360 µL), DOX (1 mg), and L-Arg (1.25 mg/μL, 40 µL) were synthesized using a simple double-emulsion method, as per a previously described protocol [30 (link)]. In addition, DiR-labeled NPs and NPs without L-Arg, DOX, or MnFe₂O₄ were prepared by using the same method.

Wang R., Cheng L., He L., Du C., Wang H., Peng B., Yu X., Liu W., Luo W., Ran H, & Yang L. (2024). Nitric oxide nano-reactor DNMF/PLGA enables tumor vascular microenvironment and chemo-hyperthermia synergetic therapy. Journal of Nanobiotechnology, 22, 110.

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!