Bamhi restriction enzyme
BamHI is a type II restriction enzyme that recognizes and cleaves the DNA sequence 5'-GGATCC-3' and its reverse complement 5'-CCTAGG-3'. It is commonly used in molecular biology and genetic engineering for DNA manipulation and analysis.
Lab products found in correlation
5 protocols using bamhi restriction enzyme
Amplification and Cloning of β-IFN MAR Subfragments
Recombinant Bmα TX14 Protein Expression
Since the protein sequence of BmαTX14 was “VRDAYIAKPENCVYHCATNEGCNKLCTDNGAESGYCQWGGKYGNACWCIKLPDDVPIRVPGKCH”, and then the cDNA sequence of the negative control for BmαTX14 was created according to the sequence of BmaTX14. The protein sequence of this negative control was “VCHGKPRVPIDVPDKLIWCCNAYGGKWGCQGYEASNGTDLCNKGCNEATHYCNVEPCAKYIDRA”. So the random protein was expressed as the negative control using pET28a-rBmαTX14 (NEG).
Cloning and Expression of Human PRRX1 Variants
Genotyping CYP2C19 Variants by PCR-RFLP
ChIP-Seq Nuclear Protein Isolation
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!