Anti dnm1l

The immortalized RPTC cell line was originally obtained from Dr. Ulrich Hopfer (Case Western Reserve University) and maintained in DMEM/F-12 medium supplemented with 10% fetal bovine serum and growth factors [47]. The retrovirus packaging cell line (293-Phoenix) was provided by Drs. Xiongjie Jin and Nahid F. Mivechi (Augusta University). The cells were cultured in DMEM medium with 10% fetal bovine serum. Primary antibodies: anti-LC3B (NB100-2220), anti-PINK1 (BC100-494) and anti-FUNDC1 (NBP1-81063) were from Novus Biologicals; anti-SQSTM1 (ab56416), anti-IMMT/MIC60 (ab110329), anti-COX4I1 (ab153709) and anti-PPIB (ab16045) were from Abcam; anti-TOMM20 (sc-11415), anti-PINK1 (sc-517353), anti-PRKN (sc-133167), anti-BNIP3L/NIX (sc-166332) and anti-HSPD1 (sc-13966) were from Santa Cruz Biotechnology; anti-CASP3 (9665) and anti-cleaved CASP3 (9664) were from Cell Signaling Technology; anti DNM1L (BD Biosciences, 611113); anti-ACTB (Sigma-Aldrich, A5316). Secondary antibodies for immunoblot analysis were from Jackson ImmunoResearch Laboratories. CCCP (C2759), chloroquine (C6628) and 3-methyladenine (M9281) were from Sigma-Aldrich. BECN1 peptide (Tat-BECN1, sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT) and its control peptide (Tat-scrambled, sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW) were synthesized by GenScript.

Immunoblot was performed as previously described^{10 (link)} using the following antibodies; mouse monoclonal anti-FLAG (Sigma, M2, 1/10,000), anti-Kif5b (Chemicon, MAB1614, 1/5,000), anti-Dnm1l (BD, 611112, 1/10,000) antibodies and Tuj1 (1/10,000), and rabbit polyclonal anti-FUS N-terminal (Bethyl, A300-302A, 1/10,000), anti-FUS C-terminal (raised against 510–523 a.a. of human FUS, 1/10,000), anti-Csde1 (Bethyl, A303–160A-T, 1/2,000), anti-Cox4 (Cell Signaling, #4844, 1/10,000) and anti-Mfn2 (Cell Signaling, #9482, 1/2,000) antibodies. Protein band quantification was performed with ImageJ (NIH). Uncropped images are shown in Supplementary Fig. S5.