Rubiscolin-6 (YPLDLF) was synthesized by a solid-phase methodology with Fmoc-strategy using an automated peptide synthesizer (Model Pioneer; Thermo Fisher Scientific, Waltham, Massachusetts, USA). The crude peptide was purified by a reverse-phase HPLC (Delta 600 HPLC System; Waters, Milford, Massachusetts, USA) on a column of Develosil ODS-HG-5 (2 × 25 cm; Nomura Chemical Co., Ltd, Seto, Japan). High purity of the purified peptide was confirmed by analytical HPLC and MALDI-TOF MS analysis.
Model pioneer
Manufactured by Thermo Fisher Scientific
Sourced in United States
The Pioneer is a high-performance laboratory instrument designed for precise and reliable sample analysis. It features advanced technology to deliver accurate and reproducible results. The core function of the Pioneer is to perform sophisticated analytical tasks, catering to the needs of modern research and testing laboratories.
Automatically generated - may contain errors
Lab products found in correlation
5 protocols using model pioneer
1
Rubiscolin-6 Peptide Synthesis and Purification
2
Synthesis and Purification of Mouse Nesfatin-1 Peptides
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Mouse nesfatin-1 was synthesized by solid-phase methodology with 9-fluorenylmethoxycarbonyl using an automated peptide synthesizer (Model Pioneer; Thermo Fisher Scientific, Inc.). The crude peptide was purified by reverse-phase high-performance liquid chromatography (HPLC; Delta 600 HPLC system; Waters Corporation) using a Develosil 300 ODS-HG-5 column (2×25 cm; Nomura Chemical Co., Ltd.). Mouse C-terminal nesfatin-1 Cys-(48 (link)–82) and mouse N-terminal nesfatin-1 (1 (link)–35 (link))-RRC were also synthesized in a manner similar to that described above. The purity of the synthetic peptides was confirmed by analytical HPLC, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry and amino acid analysis.
3
Synthesis and Characterization of VPAC Receptor Antagonists
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Xenin25 (MLTKFETKSARVKGLSFHPKRPWIL), the VPAC1 receptor antagonist PG97‐269, and the VPAC2 receptor antagonist PG99‐465 were synthesized using solid‐phase methodology according to the F‐moc strategy with an automated peptide synthesizer (Model Pioneer Thermo Fisher Scientific, Waltham, MA, USA). The crude peptides were purified using reverse‐phase HPLC (Delta 600 HPLC System; Waters, Milford, MA, USA) on a Develosil ODS‐HG‐5 column (2 × 25 cm, Nomura Chemical Co., Ltd, Seto, Japan). The purity of each peptide was confirmed by analytical HPLC and matrix‐assisted laser desorption/ionization time‐of‐flight and mass spectrometry.
4
Peptide Synthesis and Purification
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Rubiscolin-6 (YPLDLF) was synthesized by a solid-phase fluorenylmethyloxycarbonyl (Fmoc)-based strategy and an automated peptide synthesizer (Model Pioneer; Thermo Fisher Scientific), as previously described (23 (link)). The crude peptide was purified by reverse-phase high performance liquid chromatography (HPLC, Delta 600 HPLC System) using a Develosil ODSHG-5 column (2×25 cm; Nomura Chemical Co., Ltd.). High purity of the purified peptide was confirmed by analytical HPLC and MALDI-TOF MS analysis.
5
Musclin Peptide Synthesis and Purification
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Musclin (SFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG; molecular weight: 5627.4) was synthesized via a solid-phase methodology according to the Fmoc strategy using an automated peptide synthesizer (Model Pioneer, Thermo Fisher Scientific, Waltham, MA, USA). The crude peptide was purified by reverse-phase HPLC (Delta 600 HPLC System, Waters, MA, USA) using a Develosil ODS-HG-5 column (2 × 25 cm, Nomura Chemical Co., Ltd., Aichi, Japan). The purity of the peptide was confirmed using analytical HPLC, matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS), and amino acid analysis.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!