The largest database of trusted experimental protocols

8 protocols using monoclonal antibody against β actin

1

Chicken Peptide Synthesis and Validation

Check if the same lab product or an alternative is used in the 5 most similar protocols
All chemicals were purchased from Sigma-Aldrich (St. Louis, MO, USA). The pharmacological agent forskolin (an adenylate cyclase activator that can elevate intracellular cAMP levels and stimulate pituitary ACTH secretion in chickens) was supplied by Cayman Chemical Company. cNPW23 (the mature peptide form of chicken NPW that can functionally activate NPBWR2, WYKHVASPRYHTVGRASGLLMGV), cCRH (SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII) and cAVT (CYIQNCPRG) were synthesized by solid-phase Fmoc chemistry (GL Biochem Ltd, Shanghai, China). The purity of the synthesized chicken peptides was greater than 95% (analyzed by high-performance liquid chromatography), and their structures were verified by mass spectrometry. The chemically synthesized peptides were dissolved to 100 μM in Medium 199 (M199, Gibco) and stored at −80°C. A monoclonal antibody against β-actin was purchased from Cell Signaling Technology, Inc. (catalog no. 4970, RRID: AB_2223172), and a polyclonal antibody against ACTH was purchased from Abcam Company (catalog no. ab74976, RRID: AB_1280736). All primers used in this study (Table 1) were synthesized by the Beijing Genome Institute (BGI) Biological Company.
+ Open protocol
+ Expand
2

Chicken Corticotropin-Releasing Hormone

Check if the same lab product or an alternative is used in the 5 most similar protocols
All chemicals were purchased from Sigma-Aldrich (St. Louis, MO) unless stated otherwise. Primers were synthesized by Tsingke Biological Technology Co., Ltd. (Chengdu, China) and listed in Table 1. Chicken (c-) CRH (SEEPPISLDLTFHLLREVLEMARAEQL-AQQAHSNRKLMEII) and CRH2 peptides (EGKPNSLDLTFHLLREFLEMSREERLA- QKALSNKLLLQSI) with the amidated C-teminus were chemically synthesized by GL Biochem Ltd. (Shanghai, China), and reconstituted at 100 μM with Dulbecco's Modified Eagle's Medium (DMEM, Hyclone) and stored at −80°C until use. Monoclonal antibody against β-actin was purchased from Cell Signaling Technology, Inc., (Beverly, MA), while anti-ACTH antibody (ab74976) was bought from Abcam (note: the validation of antibody specificity in recognizing cACTH will be described in our coming article).
+ Open protocol
+ Expand
3

BACE1 Inhibition in Cell Signaling

Check if the same lab product or an alternative is used in the 5 most similar protocols
Dulbecco’s modified Eagle’s medium (DMEM) and fetal bovine serum (FBS) were purchased from Invitrogen (Carlsbad, CA, USA). A Cell Counting Kit-8 (CCK8) was purchased from Beyotime (Shanghai, China), β-secretase inhibitor IV (BACE1 inh.) was purchased from Biochemicals (Solon, OH, USA), and phorbol-12-myristate-13-acetate (PMA) was purchased from Sigma (St. Louis, MO, USA). Polyclonal antibodies against phospho-MEK, phospho-PKCδ, phospho-ERK, BACE1, MEK, PKCδ, and ERK and the monoclonal antibody against β-actin were purchased from Cell Signaling Technology (Danvers, MA, USA), and the anti-ST6GAL1 antibody was purchased from Santa (Dallas, Texas, USA).
+ Open protocol
+ Expand
4

Western Blot Analysis of Caspase-1 in DCs

Check if the same lab product or an alternative is used in the 5 most similar protocols
Cell lysates and supernatants from DCs culture were subjected to SDS-PAGE analysis and western blotting. The proteins were resolved on a 15% SDS-PAGE gel, and transferred to nitrocellulose membranes (Amersham Biosciences, Uppsala, Sweden). Membranes were blocked for 1 h in TBS (0.1% Tween-20; 5% non-fat dry milk) and incubated with primary antibodies at 4°C, overnight. Primary antibody used was mouse monoclonal against the p20 subunit of caspase-1 (Adipogen, San Diego, CA, United States). Monoclonal antibody against β-actin (Cell Signaling Technology, Danvers, MA, United States) was used as a loading control blot (1:1,000). The membranes were washed three times for 10 min in TBS with 0.1% Tween 20. Next, membranes were incubated for 1 h at room temperature with the suitable HRP-conjugated secondary antibody (1:1,000). Immunoreactive bands were visualized using Luminol chemiluminescent HRP substrate (Millipore).
+ Open protocol
+ Expand
5

Western Blot Analysis of Lung Proteins

Check if the same lab product or an alternative is used in the 5 most similar protocols
Lung tissues and cells were homogenized in lysis buffer with protease inhibitor cocktail (Roche, IN, USA)25 (link). After determining the protein concentration by DC protein assay kits (Bio-Rad, Hercules, CA, USA), total soluble proteins (20 μg) were separated on 4–12% gradient gels (Invitrogen, CA, USA)25 (link). The proteins were transferred to a nitrocellulose membrane (Amersham, Little Chalfont, UK). Nonspecific binding was blocked with 5% skim milk (BD, CA, USA) at room temperature for 1 h25 (link). Then, the protein blots were probed with specific primary antibodies (1:1000 dilutions) against phospho-Smad1/5 (Cell Signaling, Frankfurt, Germany), phospho-Smad2 (Millipore, MA, USA), phospho-Smad3 (Millipore, MA, USA), PECAM-1 (Millipore, MA, USA), and L- and S-endoglin (R&D Systems, Minneapolis, MN, USA) overnight at 4 °C. After incubating with host-specific secondary antibodies (goat anti-rabbit IgG-HRP) for 1 h at room temperature, the immunoreaction was detected with a chemiluminescent substrate kit (Thermo Scientific, Rockford, IL, USA) and quantitated by densitometric scanning of the X-ray film with SLB MyImager (UVP Inc, Upland, CA, USA)25 (link). The blots were normalized for protein loading by washing in stripping solution and reprobing with a monoclonal antibody against β-actin (Cell Signaling, Frankfurt, Germany)25 (link).
+ Open protocol
+ Expand
6

Apoptosis Signaling Pathway Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
ACF was purchased from Sigma-Aldrich; Merck KGaA. APC Annexin V Apoptosis Detection Kit was purchased from BioLegend, Inc (cat. no. 640930). APC anti-human IgG was purchased from BioLegend, Inc. (cat. no. 366906). ABT-263 was purchased from Santa Cruz Biotechnology, Inc. (cat. no. sc-207241). Monoclonal antibodies to detect MCL-1 (product no. 5453), GSK-3β (product no. 9315), phosphorylated (p)-GSK-3β (product no. 9323), GAPDH (product no. 2118) and polyclonal antibodies to detect p-MCL1 (product no. 4579), BCL-XL (product no. 2762), BCL-2 (product no. 2872), β-catenin (product no. 9562), cleaved PARP (product no. 9541), caspase-8 (product no. 9746), caspase-9 (product no. 9502), ubiquitin (product no. 3933), XAF1 (product no. 13805S) and XIAP (product no. 2042) were purchased from Cell Signaling Technology, Inc. Monoclonal antibody against β-actin (cat. no. A5316) was obtained from Sigma-Aldrich; Merck KGaA. Monoclonal antibodies to evaluate caspase-3 activation were purchased from Abcam (product code ab136812). MG-132 (product no. M7449), and cycloheximide (CHX; product no. C4859) were purchased from Sigma-Aldrich; Merck KGaA. Protein A/G PLUS-Agarose (cat. no. sc-2003) was purchased from Santa Cruz Biotechnology, Inc.
+ Open protocol
+ Expand
7

NDV Protein Expression Analysis in DF1 Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
DF1 cells were infected with rescued virus rmNA-1 or rmNA-VP3 at a multiplicity of infection (MOI) of 5 and incubated for 48 h. The expression of cell-associated proteins was analyzed by Western blotting. Proteins from the lysates of infected cells were separated using SDS-PAGE under denaturing conditions and analyzed with chicken serum anti-NDV or rabbit anti-VP3 polyclonal antibody (bioss), or mono-clonal antibody against β-actin (Cell Signaling). Immunostained proteins were visualized using a 3,3′-diaminobenzidine (DAB) reagent. Mock-infected DF1 cells were used as the negative control.
+ Open protocol
+ Expand
8

Immunoblotting for Cellular Protein Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Whole cell extracts from cultured cells were prepared using RIPA Lysis and Extraction Buffer containing Halt™ Protease and Phosphatase Inhibitor Cocktail (Thermo Fisher Scientific, Rockford, IL). Protein quantification was done using a BCA protein assay kit (Thermo Fisher Scientific) according to the manufacturer’s instructions. Samples were prepared with NuPAGE LDS sample buffer and NuPAGE® Sample Reducing Agent. Total protein (20–35 μg) was loaded onto NuPAGE® Novex 4–12% Bis-Tris Plus Gels with MES SDS Running Buffer with NuPAGE® Antioxidant and separated by XCell SureLock™ Mini-Cell Electrophoresis System (Thermo Fisher Scientific). Protein was transferred to iBlot® 2 Dry Blotting System and immunoblotting were carried out according to standard protocols. Monoclonal antibody against COMT was purchased from Abcam (#ab185954), whereas antibody for CASP3, cleaved CASP3, cleaved BID, XIAP, and cIAP2 were purchased from Cell Signaling Technology (Danvers, MA). Monoclonal antibody against β-Actin (Cell Signaling Technology) and GAPDH (Santa Cruz) were used to confirm equal loading. Protein complexes were visualized with Image Studio™ Software (LI-COR, Lincoln, NE) using the Odyssey® CLx Imaging System (LI-COR). The raw blotting images are available in S1 Fig.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!