The largest database of trusted experimental protocols

4 protocols using aβ 1 16

1

Immunohistochemical Analysis of Amyloid Plaques and Microglia

Check if the same lab product or an alternative is used in the 5 most similar protocols
Immunohistochemistry was performed as described previously48 (link), with minor modifications. Briefly, 30 µm coronal sections were mounted on glass slides (Menzel Gläser, Superfrost Plus, Thermo Scientific) and stained with 6E10 (1:500, mouse, Aβ 1–16, BioLegend) and Iba1 (1:300, rabbit, Wako). Secondary antibodies were anti-mouse (1:1000, wavelength 555, Alexa Fluor, Invitrogen) and anti-rabbit (1:1000, wavelength 488, Alexa Fluor, Life Technologies). The cortex (parietal association region together with the somatosensory region) and hippocampus (dentate gyrus (DG) and cornu ammonis 2 and 3 (CA2 and CA3) were analyzed in three sections per brain using an epifluorescence microscope (Olympus BX43, LRI, SE, Nikon Eclipse 80i). The number of microglia, amyloid plaques and plaque-associated microglia were analyzed using FIJI (ImageJ) software. Plaque associated microglia were defined as microglia (Iba1+) either co-localizing with the plaque (6E10+) or localized around/next to the plaque. Thioflavin-S staining and analysis were performed as described previously46 (link) and in Supplementary Methods.
+ Open protocol
+ Expand
2

Platelet Activation by Aβ1-40 and CRP

Check if the same lab product or an alternative is used in the 5 most similar protocols
Platelets were activated with CRP (Richard Farndale, University of Cambridge, United Kingdom) or soluble Aβ40 (1-40; Bachem Peptide, cat no 4014442.1000) sequence single-letter code (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV). Aβ1-40 stock solutions with a concentration of 1 mg/ml, were solved in sterile H2O and stored at -20 • C. Apyrase (grade II, from potato) and prostacyclin from Calbiochem were used for isolation.
Antibodies against phosphotyrosine (Millipore clone 4G10; cat no 05-321), phospho-LAT (Tyr 200 ; Abcam cat no ab68139); Aβ1-16 (Biolegend, 6E10, cat no SIG-39320) and fibrinogen (Dako cat no A0080) were used for immunoblotting. The antibodies to LAT (cat no 9166), βactin (cat no 4967), α-tubulin (cat no 2144), and horseradish peroxidase (HRP)-linked secondary antibodies (cat no 7074 and cat no 7076) were from Cell Signaling Technology.
+ Open protocol
+ Expand
3

Western Blot Analysis of Amyloid Aggregates

Check if the same lab product or an alternative is used in the 5 most similar protocols
Western blots were used to analyze the amount of amyloid oligomers and tetramers in the hippocampus S3 fraction, containing smaller amyloid aggregates. The western blots were performed as previously described48 (link) with the addition of a 5 min membrane incubation in boiling PBS after the transference. Membranes were stained for 6E10 (1:5000, mouse, Aβ 1–16, BioLegend) and secondary anti-mouse (1:10,000, Peroxidase Vector laboratories). Membranes were developed using the ECL clarity developing kit (BioRad) following the manufacturer’s instructions.
+ Open protocol
+ Expand
4

Dicer1 Knockdown Modulates Alzheimer's Pathology

Check if the same lab product or an alternative is used in the 5 most similar protocols
The following primary antibodies were used in this study:Dicer1(Sigma,St Louis, MO,USA,cat# WH0023405M1,RRID:AB_1841286),GFAP(Proteintech,Wuhan,China, cat#16825-1-AP,RRID:2109646),ApoE(Thermo Fisher Scientific,Carlsbad,CA,USA, Cat#701241,RRID:AB_2532438),Tubulin(Proteintech,Cat#14555-1-AP, RRID:AB_2212258),Aβ(1-16)(BioLegend,San Diego,CA,USA,Cat# 803001,RRID: AB_2721329). The following secondary antibodies were also used in this study:goat anti-mouse horseradish peroxidase conjugated IgG (Boster Biological Technology,Co.
Ltd,Wuhan,China),goat anti-Rabbit horseradish peroxidase conjugated IgG(Boster Biological Technology). The following reagents or cell lines were used in this study:the Dicer1 siRNA duplex and the negative control(NC) siRNA duplex (Genepharma, Suzhou,China),pfu High fidelity enzyme(Qiagen,Beijing,China,cat#KP202),pJet1.2 vector(Thermo Fisher Scientific,Carlsbad,CA,USA,cat# K1231),pGL6-miR-basic (Beyotime Biotechnology,Haimen,China),pRL-TK Vector(Beyotime Biotechnology,Inc, cat#D2762),a human pCMV-Dicer 1(Sino Biological,Beijing,China,cat# HG11350-NH), U87MG cell line(ATCC,Manassas,VA cat#HTB-14,RRID:CVCL_0022).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!