The largest database of trusted experimental protocols

Ccr5 antibody

Manufactured by Santa Cruz Biotechnology

The CCR5 antibody is a laboratory reagent used in scientific research. It is a monoclonal antibody that specifically binds to the CCR5 chemokine receptor, a cell surface protein. The CCR5 antibody can be used to detect and study the expression of the CCR5 receptor in various cell types and biological samples.

Automatically generated - may contain errors

2 protocols using ccr5 antibody

1

CCL11-CCR5 Interaction Quantification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Recombinant CCL11 was coated onto the wells of maxisorp 96-well microtiter plates and incubated for 18 hours at 4°C. Each well was washed three times with PBST (0.2% Tween-20 in PBS). Thereafter, the plates were blocked with 2% BSA in PBST for 2 hours. Cell lysates were added to the plates and incubated for 2 hours. The wells were then washed three times [27 (link)]. Preparations of the CCR5 antibody (Santa Cruz Biotechnology) in blocking solution were added to the plates and allowed to react for 2 hours. After washing, horseradish peroxidase (HRP)-linked antibody (Cell signaling Technology) was added and the lysates were incubated for 2 hours; this was followed by five rounds of washes. The reaction was developed with 100 μL tetramethylbenzidine (TMB) substrate solution and stopped with 100 μL of 1 N H2SO4. The absorbance in the microtiter plates was measured at 450 nm using a microplate reader (Infinite 200 PRO; Tecan Life Sciences, Zürich, Switzerland).
+ Open protocol
+ Expand
2

V3-HA Peptide-CCR5 Binding Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols
V3-HA peptide (CTRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHCGYPYDVPDYA, Disulfide Bridge: 1–35, from GenScript) and hippocampal CCR5 binding was detected with Pierce co-Immunoprecipitation (Co-IP) kit. Mouse hippocampal tissue was prepared with IP Lysis/Wash Buffer, and was mixed with anti-HA-agarose (Sigma) and incubated overnight at 4°C with or without V3-HA peptide. After elution, the samples were detected with CCR5 antibody (Santa Cruz Biotechnology) with western blot.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!