Arginine vasopressin avp

Manufactured by Merck Group

Sourced in United States

Arginine vasopressin (AVP) is a peptide hormone that plays a key role in the regulation of water and blood pressure in the human body. It is responsible for the reabsorption of water in the kidneys, helping to maintain fluid balance. AVP also acts as a vasoconstrictor, increasing blood pressure by narrowing blood vessels. This lab equipment product is intended for research purposes to study the physiological functions of AVP.

Automatically generated - may contain errors

Lab products found in correlation

6 protocols using arginine vasopressin avp

G Protein-Coupled Receptor Assay Protocols

Cited 2 times

Check if the same lab product or an alternative is used in the 5 most similar protocols

Arginine vasopressin (AVP) was purchased from Sigma-Aldrich. The OPC analogues (OPC-51803 (OPC5), OPC16b, OPC16g, OPC16j, OPC19a, OPC19b, OPC23b, OPC23d, OPC23h and OPC23i) and OPC4 (OPC41061) were kindly provided by Otsuka Pharmaceutical Company. Plasmids for the NanoBiT-β-arrestin-recruitment assay and GloSensor-based cAMP assay were previously described [19 (link), 20 (link)]. For HiBiT-based luciferase-fragment complementation assay, human full-length V2R were N-terminally fused to a HiBiT cassette (HiBiT-V2R), which contained an interleukin 6 (IL6)-derived signal sequence followed by a HiBiT sequence and a linker at the N terminus (MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVSGWRLFKKISGGSGGGGSG; HiBiT tag underlined; gene synthesized with codon optimization). Unless otherwise indicated, all the constructs were inserted into the pCAGGS expression plasmid vector. The V2R mutant constructs (V88^2.53M, Y128^3.41S, L161^4.47P, T273^6.37M, S329^8.47R and S333^8.51del) were generated by an in-house-modified QuikChange Site-Directed Mutagenesis Kit.

Kuramoto R., Kise R., Kanno M., Kawakami K., Ikuta T., Makita N, & Inoue A. (2024). Therapeutic potentials of nonpeptidic V2R agonists for partial cNDI-causing V2R mutants. PLOS ONE, 19(5), e0303507.

+ Open protocol

+ Expand

Cell Lines and Reagents for Bioassays

Check if the same lab product or an alternative is used in the 5 most similar protocols

A transfected Chinese hamster ovary (CHO), Hela, a murine interleukin-3 dependent pro-B (Ba/F3), PC12, and rat basophil leukemia cell lines were obtained from Eurofins Scientific (Eurofins-Cerep, Le Bois I’Eveque, France). Buffers—Dulbecco’s modified Eagle medium (DMEM) buffer, 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) buffer, and Hank’s balanced salt solution (HBSS) buffer—were purchased from Invitrogen (Carlsbad, CA, USA). The reference agonists: 5′-N-ethylcarboxamidoadenosine (NECA), epinephrine bitartrate, epinephrine, DPDPE, CP 55940, linoleic acid, GLP-1(7–37, arginine vasopressin (AVP), and serotonin, and antagonists: ZM 241385, RX-821002, rauwolscine, naltriben mesylate, AM 281, exendin-3(9–39), [d(CH₂)₅¹, Tyr (Me)₂]-AVP, (S)-WAY-100635, and GR55562) were obtained from Sigma-Aldrich (St. Louis, MO, USA). All other chemicals and reagents purchased from Merck and Fluka were of the highest available grade unless otherwise stated.

Paudel P., Seong S.H., Park S.E., Ryu J.H., Jung H.A, & Choi J.S. (2021). In Vitro and In Silico Characterization of G-Protein Coupled Receptor (GPCR) Targets of Phlorofucofuroeckol-A and Dieckol. Marine Drugs, 19(6), 326.

+ Open protocol

+ Expand

Arginine Vasopressin Antagonist Study

Check if the same lab product or an alternative is used in the 5 most similar protocols

Arginine vasopressin (AVP), SR49059, neutral red, and Hexamethonium were purchased from Sigma, USA, and chloral hydrate and NaCl were purchased from Tiancheng, Chemical Ltd., China. All chemicals were in technical grade of more than 95% purity. All drugs were dissolved in normal saline (NS) and prepared immediately before use.

Zhu J., Chang L., Xie J, & Ai H. (2015). Arginine Vasopressin Injected into the Dorsal Motor Nucleus of the Vagus Inhibits Gastric Motility in Rats. Gastroenterology Research and Practice, 2016, 4618672.

+ Open protocol

+ Expand

HTRF Phospho-ERK Assay with GPCR Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols

We used the HTRF^® Phospho-ERK kit (Catalog number 64ERKPEG) recently launched by Cisbio Bioassays. Chinese hamster ovary (CHO) cells stably expressing the different GPCRs were generated by Euroscreen (Gosselies, Belgium), except the CHO–muscarinic M1 receptor (M1) cell line that was kindly provided by Dr. Denis Servent (CEA–DSV, Saclay, France). NIH-3T3, A431, HEK293, HeLa, and SKOV3 cell lines were from American Type Culture Collection (Manassas, VA, USA). HEK293FT cells were from Life Technologies (Burwood, VIC, Australia). All the plasmids coding for the GPCRs used in Figure 4 were generated and/or purchased by Kevin D. G. Pfleger’s laboratory from Missouri S&T cDNA Resource Center¹ and AT1R and NMU2R plasmids were gifts from Prof. Walter Thomas (University of Queensland, Australia) and Dr. Gary B. Willars (University of Leicester, UK), respectively. All the agonists (EGF, MCP-1, MIP1β, SDF1α, DAMGO, Endorphin-2, Norepinephrine, Isoproterenol, ACEA, PGE2, ITAC, FTY720, VIP, arginine-vasopressin (AVP), carbachol, Ang II, and human Neuromedin U-25), the antagonist CTOP and Pertussis toxin were from Sigma. The anti-Phospho-ERK1/2 antibody used for western blot was purchased from Cell Signaling Technology.

Ayoub M.A., Trebaux J., Vallaghe J., Charrier-Savournin F., Al-Hosaini K., Gonzalez Moya A., Pin J.P., Pfleger K.D, & Trinquet E. (2014). Homogeneous Time-Resolved Fluorescence-Based Assay to Monitor Extracellular Signal-Regulated Kinase Signaling in a High-Throughput Format. Frontiers in Endocrinology, 5, 94.

+ Open protocol

+ Expand

Anabolic Hormones and Vasopressin Regulation

Check if the same lab product or an alternative is used in the 5 most similar protocols

Testosterone cypionate, nandrolone decanoate, and boldenone undecylenate were purchased from Steraloids Inc (Newport, RI) and prepared in sesame oil (SO). The neuropeptide arginine vasopressin (AVP) and the linear AVP V1A receptor antagonist (Manning Compound) [OH-Phaa-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-NH₂] were purchased from Sigma Aldrich (St. Louis, MO). Manning compound was dissolved in in 0.9% (wt/vol) normal saline and AVP was dissolved in ddH20.

Morrison T.R., Ricci L.A, & Melloni RH J.r. (2016). Vasopressin Differentially Modulates Aggression and Anxiety in Adolescent Hamsters Administered Anabolic Steroids. Hormones and behavior, 86, 55-63.

+ Open protocol

+ Expand

Signaling Pathway Modulation Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols

Forskolin, 3-isobutyl-1-methylxanthine (IBMX), and dibutyryl-cAMP (db-cAMP) were from Serva, Germany. Cell culture media and Pen Strep are from Life Technologies Europe BV. KG-501 was from Società Italiana Chimici, SIC, Italy. b-FGF was from Merck Darmstadt Germany. Sphingosine-1-phosphate (S1P) and argininevasopressin (AVP) were from Sigma Aldrich.

Innamorati G., Ridolfi G., Steccanella F., Bormetti A., Dallatana A., Bozzetto C., Ottoboni L., Di Chio M, & Giacomello L. (2022). cAMP Response Element-Binding Protein Controls the Appearance of Neuron-Like Traits in Chorion Mesenchymal Cells. Frontiers in bioscience (Landmark edition), 27(8).

+ Open protocol

+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Revolutionizing how scientists
search and build protocols!