Pramipexole (Pramipexole dihydrochloride, Sigma Aldrich, St Louis, MO, USA) was prepared in saline and injected at two different doses (1 and 3 mg/kg body weight). For the PPI test with drug treatment, Meis1 and control mice were assigned to receive either Pramipexole (1 and 3 mg/kg body weight) or saline vehicle and this was balanced for genotype, startle chamber and treatment. The mice were tested for PPI 1 h after administration of the treatment and the i.p. injection volume was 10 ml/kg body weight. The experimenter was not blinded during the PPI testing as the test is automated and there was no possibility for observer bias.
Pramipexole
Manufactured by Merck Group
Sourced in United States
Pramipexole is a pharmaceutical product manufactured by Merck Group. It is a dopamine agonist, which means it stimulates the receptors for the neurotransmitter dopamine in the brain. Pramipexole is primarily used for the treatment of Parkinson's disease and restless leg syndrome.
Automatically generated - may contain errors
Lab products found in correlation
Ellagic acid, by Merck Group (2 mentions)
Serotonin, by Merck Group (1 mentions)
Apomorphine, by Merck Group (1 mentions)
Ketamine xylazine, by Alfasan (1 mentions)
Desipramine, by Merck Group (1 mentions)
Ketamine, by Alfasan (1 mentions)
Xylazine, by Alfasan (1 mentions)
Reserpine, by Merck Group (1 mentions)
Pregabalin, by Merck Group (1 mentions)
Diphtheria toxin, by List Biological Laboratories (1 mentions)
Skf81297, by Bio-Techne (1 mentions)
7 protocols using pramipexole
1
Pramipexole Effects on Prepulse Inhibition
2
Serotonin and Pramipexole Treatment Assay
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
To assess treatment responses, serotonin (Sigma) or pramipexole (Sigma) were spread on top of agarose plates to a final concentration of 5 mM and given time to be absorbed. As soon as the solutions were absorbed into the agar (determined by visual inspection), the phenotyping assays were conducted.
3
Parkinson's Disease Pharmacological Intervention
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
6-hydroxidopamine (6-OHDA), desipramine, apomorphine, ellagic acid (EA) and pramipexole (PPX) were purchased from Sigma-Aldrich Chemical Co. (St. Louis, MO, USA). Ketamine/xylazine were obtained from Alfasan Co. (Woerden, Holland).
4
6-OHDA-Induced Neuroinflammation Model
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Drugs and assay kits: 6-hydroxidopamine (6-OHDA), desipramine, apomorphine, ellagic acid (EA) and pramipexole (PPX) were purchased from Sigma-Aldrich Chemical Company (St. Louis, MO, USA). Ketamine and xylazine were obtained from Alfasan Company (Woerden, Holland). ELISA kits for IL-1beta (IL-1b) and TNF-alpha (TNF-a) were obtained from eBioscience Company (Vienna, Austria).
5
Tx3-3 Toxin Purification and Characterization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Reserpine, pregabalin, and pramipexole were obtained from Sigma-Aldrich (USA). Duloxetine was acquired from the Lilly Laboratory (Brazil). Before the experiments, Reserpine was dissolved in acetic acid and then diluted to a final concentration of 0.5% acetic acid with distilled water. The control drugs of pregabalin, pramipexole, and duloxetine were diluted in a sterile saline solution (NaCl 0.9%).
The Tx3-3 toxin purification was performed by a combination of chromatographic steps, according to the method of Cordeiro Mdo et al. (1993) (link). The purification presented a purity that was better than 95%. The amino acid sequence of the toxin was GKCADA-WESCDNYPCCVVNGYSRTCMCSANRCNCDDTKTLREHFG and its molecular weight was 510,000 Da. The Tx3-3 toxin isolation, purification, and amino acid sequencing were carried out by the Ezequiel Dias Foundation (FUNED, Brazil). The Tx3-3 toxin was received in a lyophilized form and then dissolved in phosphate-buffered saline (PBS, mmol/ L composition: NaCl 137, KCl 2.7, and phosphate buffer 10, pH 7.4).
The Tx3-3 toxin purification was performed by a combination of chromatographic steps, according to the method of Cordeiro Mdo et al. (1993) (link). The purification presented a purity that was better than 95%. The amino acid sequence of the toxin was GKCADA-WESCDNYPCCVVNGYSRTCMCSANRCNCDDTKTLREHFG and its molecular weight was 510,000 Da. The Tx3-3 toxin isolation, purification, and amino acid sequencing were carried out by the Ezequiel Dias Foundation (FUNED, Brazil). The Tx3-3 toxin was received in a lyophilized form and then dissolved in phosphate-buffered saline (PBS, mmol/ L composition: NaCl 137, KCl 2.7, and phosphate buffer 10, pH 7.4).
6
Pramipexole Exposure in Peripubertal Mice
7
Diphtheria Toxin and Dopaminergic Agonists
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!