The solvents and metal salts used in the experiments were of analytical or higher grade, purchased from various suppliers: methanol (MeOH), acetonitrile (ACN), n-hexane, toluene and 2-propanol from LabScan (Ireland), nitromethane (MeNO2), acetone, ethyl acetate (EtAcO), glacial acetic acid, diethyl ether, 1,4-dioxane as well as Cd(NO3)2, all the chlorides and acetates from POCh (Poland), dimethylformamide (DMF), dimethylsulfoxide (DMSO) and Cu(ClO4)2 from Sigma-Aldrich (Germany), Zn(CF3SO3)2 and Pb(NO3)2 from Fluka (Switzerland), Ni(ClO4)2 and Co(ClO4)2 from Strem Chemicals (USA). In the kinetic studies, the solvents and the salts were used as supplied.
Cu clo4 2
Manufactured by Merck Group
Sourced in Germany
Cu(ClO4)2 is an inorganic chemical compound that consists of copper(II) ions and perchlorate ions. It is a crystalline solid that is soluble in water and other polar solvents. Cu(ClO4)2 is commonly used as a precursor in various chemical reactions and applications, but a detailed description of its core function cannot be provided while maintaining an unbiased and factual approach.
Automatically generated - may contain errors
Lab products found in correlation
Zn clo4 2, by Merck Group (3 mentions)
Carbonate free stock solution of 0.1 m naoh, by Merck Group (2 mentions)
Naclo4, by Merck Group (2 mentions)
Dimethyl sulfoxide (dmso), by Merck Group (1 mentions)
Methanol, by RCI Labscan (1 mentions)
Acetonitrile, by RCI Labscan (1 mentions)
N hexane, by RCI Labscan (1 mentions)
Potassium hydrogen phthalate, by Merck Group (1 mentions)
Triton x 100, by Merck Group (1 mentions)
Sephadex g 50, by Merck Group (1 mentions)
Sodium chloride (nacl), by Merck Group (1 mentions)
Tryptic soy broth (tsb), by Thermo Fisher Scientific (1 mentions)
Cholesterol, by Merck Group (1 mentions)
6 carboxyfluorescein, by Merck Group (1 mentions)
Hclo4, by Avantor (1 mentions)
2 3 5 triphenyltetrazolium chloride ttc, by Thermo Fisher Scientific (1 mentions)
6 protocols using cu clo4 2
1
Kinetic Studies of Metal Complexes
2
Synthesis and Characterization of Amylin Analogues
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
All the ligands, the C-protected disulfide-bridged rat amylin (KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2), C-protected disulfide bridged amylin1–19 (KCNTATCATQRLANFLVHS-NH2), C-protected disulfide bridged pramlintide (KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2) and C-protected disulfide bridged Ac-pramlintide (Ac-KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2) were purchased from KareBayBiochem (USA) (certified purity of 99.30%) and used as received. The purity was checked potentiometrically. The Cu(ClO4)2 was an extra pure product (Sigma-Aldrich). The carbonate-free stock solution of 0.1 M NaOH was purchased from Merck and then potentiometrically standardized with potassium hydrogen phthalate.
3
Potentiometric Study of Metal-Peptide Interactions
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
The N- and C-terminally protected MB3 (Ac-HHASHGHHNSHHPQHHHHHHHHHHH-NH2) and MB6 (Ac-HHHGAHHAAHHHHAAHHHHHHHHHSHGGAGHGGGAGHH-NH2) fragments were purchased from KareBayBiochem (USA) (certified purity 98%) and used as received. Their purity was checked potentiometrically. Cu(ClO4)2 and Zn(ClO4)2 were extra pure products (Sigma-Aldrich); concentration of their stock solutions was determined by ICP–MS. The carbonate-free stock solution of 0.1 mol dm−3 NaOH was potentiometrically standardized with potassium hydrogen phthalate (both Sigma-Aldrich). All samples were prepared with freshly doubly distilled water. The ionic strength (I) was adjusted to 0.1 M by addition of NaClO4 (Sigma-Aldrich).
4
Standardization and Characterization of Peptides
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
All peptides (GDDDDDD, DDDDDDD, GADDDDD) were purchased from KareBay Biochem (USA) and were used as received (certified purity—98%). Carbonate-free stock solutions of 0.1 M NaOH were purchased from Sigma-Aldrich and then potentiometrically standardized with potassium phthalate (99.9% purity). Ethylene glycol and chloroform were bought from Chempur (pure p.a.). Methanol used for mass spectroscopy was purchased from J.T. Baker (LC-MS). NaClO4, Cu(ClO4)2, Zn(ClO4)2, NaCl, cholesterol, Triton X100, Sephadex G-50 and 6-carboxyfluorescein were bought from Sigma Aldrich. HClO4 was ordered from VWR. Lipids used for liposome experiments (DOPC, DOPA) were purchased from Avanti Polar Lipids. For antimicrobial susceptibility testing, tryptic soy broth (TSB) was acquired from Oxoid, whereas 2,3,5-triphenyltetrazolium chloride (TTC) was purchased from Alfa Aesar.
5
Peptide Purity and Reagent Standardization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
All the ligand–unprotected peptides (AVPQEVLNENLLR, YLQGSNLVVPLTDD, KFKGFVEPFPAVE, and FVAPEPFVFGKEK) were purchased from KareBay Biochem (United States) (certified purity of 98.00%) and used as received. The purity was checked potentiometrically. Cu(ClO4)2 was an extra-pure product (Sigma-Aldrich). The carbonate-free stock solution of 0.1 M NaOH was purchased from Merck and then standardized potentiometrically with potassium hydrogen phthalate.
6
Amylin 1-19 Peptide Characterization
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
The C-protected disulphide-bridged amylin 1-19 (KC̲ NTATC̲ ATQRLANFLVHS-NH 2 ) was purchased from KareBay Biochem (USA) (certified purity: 99.30%) and was used as received. Its purity was checked potentiometrically. Cu(ClO 4 ) 2 and Zn(ClO 4 ) 2 were extra pure products (Sigma-Aldrich); the concentrations of their stock solutions were determined by ICP-MS. The carbonate-free stock solution of 0.1 mol dm -3 KOH was purchased from Sigma-Aldrich and then potentiometrically standardized with potassium hydrogen phthalate.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!