The largest database of trusted experimental protocols

6 protocols using millipore direct q

1

Altitude-Dependent Oolong Tea Composition

Check if the same lab product or an alternative is used in the 5 most similar protocols
(−)-EC, (−)-EGC, (−)-EC gallate (ECG), and (−)-EGC gallate (EGCG) [high performance liquid chromatography (HPLC) ≥98%] were purchased from QualiFlex Co. (Taipei, Taiwan). Caffeine (≥99%) was obtained from Merck KGaA (Darmstadt, Germany). Acetic acid (99.7%) was purchased from J. T Baker (Mallinckrodt Baker, Inc., Phillipsburg, NJ, USA). Acetonitrile (HPLC grade) was obtained from Thermo Fisher Scientific (Waltham, MA, USA). Water was purified by a Millipore clear water purification system (Millipore Direct-Q, Millipore, Bedford, MA, USA).
All of the fresh tea leaves and oolong tea granules were obtained from the same tea plant cultivar, Camellia sinensis L., Chin-Shin oolong, grown at different altitudes in the same mountain area of Center Taiwan in November 2012 and December 2012. Both fresh tea leaves (with young green shoots used for the preparation of oolong tea) and their consequent oolong tea granules were obtained from three tea farms at altitudes of 200 m, 800 m, and 1300 m, respectively. In addition, seven more fresh leaves from altitudes of 220 m, 400 m, 1000 m, 1200 m, 1350 m, 1550 m, and 1600 m, as well as seven more oolong tea granules from altitudes of 170 m, 850 m, 900 m, 950 m, 1100 m, 1500 m, and 1600 m were collected for the following analysis.
+ Open protocol
+ Expand
2

Diverse Peptide Synthesis and Characterization

Check if the same lab product or an alternative is used in the 5 most similar protocols
Peptides RKRRQtSM, RQSVELHsPQSLPR, RGDC, RPHERNGFTVLCPKN, HCLGKWLGHPDKF, NTWTTCQSIAFPSK, and SHLVEALYLVCGERG were purchased from Anaspec (San Jose, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA). CDPGYIGSR was purchased from Apexbio, and CGYGPKKKRKVGG was purchased from American Peptide Company (Sunnyvale, CA). GSNKGAIIGLM (Piscataway, NJ) was purchased from GenScript. DRVYIHPF was purchased from Sigma-Aldrich (St. Louis, MO). Naphthoquinone (NQ), iodoacetamide and dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Benzoquinone (BQ), benzyl mercaptan (BM), and trifluoroacetic acid (TFA) were purchased from Alfa Aesar (Haverhill, MA). Naphthalenethiol (NT) was purchased from Fluka Analytical (Mexico City, Mexico). Iodomethane was purchased from Arcos Organics (Geel, Belgium). Chloramine-T, sodium metabisulfite, and sodium iodide were purchased from Fisher Chemical (Fairlawn, NJ). Acetonitrile (ACN) and methanol were purchased from Fisher Scientific (Waltham, MA). Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A Macrotrap holder and Macrotrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc (Auburn, CA).
+ Open protocol
+ Expand
3

Synthesis of Selenomethionine-Labeled Peptides

Check if the same lab product or an alternative is used in the 5 most similar protocols
Methanol was purchased from Fisher Scientific (Waltham, MA). Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). Fmoc-SeMet was purchased from Matrix scientific (Columbia, Sc). Polyalanine peptides were synthesized with the following sequences: Ac-A5XA3MK and Ac-A5 XA3MSeK (where X = Y, F or W), A3MK, and A3MSeK. Additionally, a series of SeMet helical peptides were synthesized containing either tyrosine or tryptophan with the following sequences: Ac-XA8MSeK, Ac-AXA7MSeK, Ac-A2XA6MSeK, Ac-A3XA5MSeK, Ac-A4XA4MSeK, Ac-A5XA3MSeK, (X = Y or W). A series of peptides with tryptophan near the C-terminus were also made with the following sequences: Ac-MSeA8WK, Ac-AMSeA7WK, Ac-A2MSeA6WK, Ac-A3MSeA5WK, Ac-A4MSeA4WK, and Ac-A5MSeA3WK. Peptides were synthesized following standard solid phase peptide synthesis procedures for most amino acid additions.37 The coupling and deprotection steps were completed in six minutes for all amino acids except SeMet, for which coupling was extended to 1.5 hr.
+ Open protocol
+ Expand
4

Peptide Synthesis and Purification

Check if the same lab product or an alternative is used in the 5 most similar protocols
Peptides RGDC, VTCG, PHCKRM, YGLSKGCFGLKLDRIGSMSGLGC, and SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY were purchased from American Peptide Company (Sunnyvale, CA). SLRRSSCFGGR and CQDSETRTFY were purchased from Abbiotec (San Diego, CA) and CDPGYIGSR was purchased from Apexbio. Ammonium bicarbonate was purchased from Avantor (Center Valley, PA). Dithiothreitol was purchased from Arcos Organics (Geel, Belgium). Dimethyl sulfoxide (DMSO) were purchased from Sigma-Aldrich (St. Louis, MO). Trifluoroacetic acid (TFA) and N,N’-Dicyclohexylcarbodiimide was purchased from Alfa Aesar (Haverhill, MA). Acetonitrile (ACN), methanol and 1,4 dioxane were purchased from Fisher Scientific (Waltham, MA). 2-hydroxymethyl-18-crown-6 ether was purchased from TCI America (Portland, OR) and 3,5-diiodobenzoic acid was purchased commercially. Water was purified by Millipore Direct-Q (Millipore, Billerica, MA). A MacroTrap holder and MacroTrap consisting of polymeric reversed-phase packing material were purchased from Michrom Bioresources, Inc. (Auburn, CA).
+ Open protocol
+ Expand
5

Argan Cake Waste to Carbon Nanodots

Check if the same lab product or an alternative is used in the 5 most similar protocols
Argan cake waste obtained during argan oil preparation through cold pressing (provided by a local Moroccan co-operative) was used as precursor of the CNDs. Ultra-pure distilled water (Millipore-Direct Q, Millipore, San Salvador, Salvador), ethanol (EtOH), chloroform (CLF), and tetrahydrofuran (THF) (Merck-Sigma-Aldrich, Bucharest, Romania) were used as dispersion media and solvents of the polymer matrices. Poly(styrene-co-acrylonitrile) (PSA) (Mw = 165,000) and cyclo-olefin copolymer (COC) pellets (Mw = 180,000) were also supplied by Merck-Sigma-Aldrich, Bucharest, Romania.
+ Open protocol
+ Expand
6

Analytical Reference Standards Characterization

Check if the same lab product or an alternative is used in the 5 most similar protocols
The Analytical Reference Standards of 4-MMC hydrochloride in the form of crystalline powder and 4-MEC hydrochloride in methanolic solution and crystalline powder were supplied by Cayman Chemical Company. The standards were reconstituted in methanol 99.99% purchased from Fisher Scientific (Optima® Grade) at different concentrations. Sulfuric acid (H2SO4) was supplied by Fisher Scientific and D-(+)-maltose monohydrate by MP Biomedicals LLC. All solutions were prepared with deionized water of resistivity 18.2 MΩ-cm supplied by the system Millipore Direct-Q®.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!