The largest database of trusted experimental protocols

Plvx ires zsgreen

Manufactured by Takara Bio
Sourced in United States, China

The PLVX-IRES-ZsGreen is a lentiviral vector that allows for bicistronic expression of a gene of interest and the ZsGreen fluorescent protein. The ZsGreen marker can be used to monitor transduction efficiency. The vector contains an internal ribosome entry site (IRES) sequence that enables the translation of two open reading frames from a single mRNA transcript.

Automatically generated - may contain errors

23 protocols using plvx ires zsgreen

1

Recombinant Human BAFF Protein Production

Check if the same lab product or an alternative is used in the 5 most similar protocols

Example 6

Stable HEK293F cells expressing human BAFF(134-285) with an N-terminal His-tag (SEQ ID: 401) was produced using lentivirus based technologies from Clontech (pLVX-IRES-ZsGreen). The lentivirus line was generated using Clontech's standard protocols, and high-expressing cells were enriched by sorting for cells expressing green fluorescent protein. BAFF(134-285) expressing HEK293F cells were incubated for 96 hours before cells were pelleted and expression of the supernatant was verified with an anti 6×His western blot (“6×His” disclosed as SEQ ID NO: 407). Supernatant purification was completed using Ni-Sepharose Affinity Chromatography as first step. Affinity purified BAFF(134-285) was polished by Size Exclusion Chromatography using Sephacryl S-400 resin. 60-mer BAFF eluted as major peak that was separated from both larger aggregates and small molecular weight species. The molecular weight of 60-mer BAFF was confirmed by Analytical Ultracentrifugation and SEC-multi angle laser light scattering detector system.

Sequence for His-HuBAFF (134-285):

(SEQ ID NO: 401)
HHHHHHENLYFQGAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPW
LLSFKRGSALEEKENKILVKETGYFFIYGVLYTDKTYAMGHLIQRKKVHV
FGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPREN
AQISLDGDVTFFGALKLL

+ Open protocol
+ Expand
2

Plasmid-Based Viral Gene Expression

Check if the same lab product or an alternative is used in the 5 most similar protocols
pDZ plasmids contain a bidirectional expression cassette for a given influenza A virus gene segment and have been described previously (45 (link)). pCAGGS-based expression plasmids contain protein-coding sequences under the control of the chicken β-actin promoter (46 (link)). pMD2.G and psPAX2 were a gift from Didier Trono (Addgene; plasmid 12259).
pLVX-IRES-ZsGreen and pLVX-IRES-Puro were purchased from Clontech (respectively, 632187 and 632183). pSpCas9(BB)-2A-GFP (PX458) was a gift from Feng Zhang (Addgene; plasmid 48138) (47 (link)). BiFC expression plasmids for split-YFP were described previously (20 (link)). pmTurquoise2-Mito and pmTurquoise2-ER were a gift from Dorus Gadella (Addgene; plasmids 36208 and 36204, respectively) (48 (link)).
+ Open protocol
+ Expand
3

Lentiviral Transduction of TGF-β1 in Mesenchymal Stem Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
TGF-β1 cDNA (NM_000660.6) cDNA cloned into the lentivector-transferred plasmid pLVX-IRES-ZsGreen (Clontech Laboratories, Inc.) was obtained from GenePharma Co. and named Lenti-TGF-β1. Lentiviruses were generated by co-transfecting the packaging vectors psPAX2 and pMD2.G into 293T cells. The supernatants were collected, filtered, and concentrated after culturing for 72 h.
Lentiviruses encoding short hairpin (sh) RNA of TGF-β1 with a target sequence of 5′-GCAGAGTACACACAGCATATA-3′ (shTGF-β1) were generated by GenePharma Co. The sequence 5′-TTCTCCGAACGTGCACGTTTC-3′ was used as a negative control (shNC). pGLVH1/GFP/Puro (Gene Pharma) and packing plasmids (pGag/Pol, pRev, and pVSV-G) were transfected into 293T cells to produce lentiviruses. The culture supernatants containing lentiviruses were filtered and concentrated at 3 days after transfection.
Transfection of MSCs was performed by incubating them in medium containing the lentivirus and Polybrene (5 μg/ml) for 24 h at a multiplicity of infection (MOI) of 50. Related experiments were performed later.
+ Open protocol
+ Expand
4

Generation of ACE2 and TMPRSS2 Expressing HEK293T Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
HEK293T cells stably expressing human ACE2 and TMPRSS2 were generated by lentiviral transductions as previously described23 (link). Briefly, the open reading frames for hACE2 (Addgene, 1786) and hTMPRSS2a (IDT, synthetic gene fragment) were cloned into lentiviral expression vectors pRRLsinPPT.CMV.GFP.WPRE52 (link) and pLVX-IRES-ZsGreen (Clontech, 632187), respectively. For ACE2 cloning, Age1/Bsrg1 cut sites were used to replace GFP with ACE2, while hTMPRSS2a was cloned into pLVX-IRES-ZsGreen using EcoR1/XhoI restriction sites. Lentiviral particles expressing the above genes were produced by co-transfecting expression plasmids individually with a 2nd generation lentiviral packaging construct psPAX2 (courtesy of Dr Didier Trono through NIH AIDS repository) and VSVG plasmid pMD2.G (Addgene, 2259) in HEK293T producer cells using polyethyleneimine as previously described53 (link). Virus supernatant was collected 72 h post-transfection, pre-cleared of cellular debris and centrifuged at 28,000 × g for 90 min at 4 °C to generate concentrated virus stocks. Two successive rounds of lentiviral transductions were then performed on HEK293T cells to generate ACE2-TMPRSS2 HEK293T cells. Clonal selection led to the identification of a highly permissive clone (HAT-24), which was then used in subsequent experiments23 (link).
+ Open protocol
+ Expand
5

Culturing and Transfection of C2C12 and HEK 293 Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
The C2C12 cell line was purchased from American Type Culture Collection (ATCC, CRL-1772™) and cultured as described.60 (link) Briefly, C2C12 cells and HEK 293 cells were cultured in DMEM medium supplemented with 10% fetal bovine serum. The cells were transfected using Lipofectamine 2000 or 3000 (Invitrogen, 11668019 and L3000015).
Overexpression of CAR3 in C2C12 cells was performed with lentivirus based on pLVX-IRES-zsGreen (Clontech Laboratories, 632187) containing the Car3 sequence amplified from mouse cDNA. siRNAs targeting Bag3, Car2, and Car3, and scrambled siRNA were purchased from Life Technologies (71816, 66069, and 60576), and knockdown assays were performed as previously described.61 (link)
+ Open protocol
+ Expand
6

Lentiviral Overexpression of Dlk1M in Dlk1- Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
Overexpression of Dlk1M in Dlk1 cells was achieved with lentivirus based on a pLVX-IRES-zsGreen (Clontech, Japan) vector containing the Dlk1M sequence amplified from mouse cDNA with the forward primer 5′-CCGGAATTCATGATCGCGACCGGAGCCCT-3′ and reverse primer 5′-CGCGGATCCTTAGATCTCCTCATCACCA-3′. 293T cells were transfected with mock or Dlk1M vector using Lipofectamine 2000 (Invitrogen, Carlsbad, CA, USA). Lentivirus was collected 3 days later and used to transduce Dlk1 cells using Lipofectamine 2000 as previously described [21 (link)].
+ Open protocol
+ Expand
7

Lentiviral Vector Encoding HPV-18 E2 Protein

Check if the same lab product or an alternative is used in the 5 most similar protocols
HPV-18 E2 ORF was synthetized and cloned by Genscript into the bicistronic lentiviral vector pLVX-IRES-ZsGreen (Clontech, Mountain View, CA, USA). The sequence was partially modified to optimize translation of E2 (Supplementary Fig. 1). Lentiviral particles were produced by co-transfection of lentiviral vector encoding HPV-18 E2, or the empty vector as control (ZsGreen), with the ViraPower packaging system (Invitrogen, MA, USA) into HEK293T cells, using Lipofectamine2000 (Invitrogen, MA, USA) according to manufacturer’s directions [14 (link)]. After 48 h, viral particles were harvested and concentrated by ultracentrifugation, and the viral titer was determined by serial dilutions using HEK293FT cells, followed by flow cytometry analysis of ZsGreen expression 72 h post-transduction (BD FacsCanto II).
+ Open protocol
+ Expand
8

Overexpression of Mutant β-Catenin in HCT116 Cells

Check if the same lab product or an alternative is used in the 5 most similar protocols
Flag-tagged β-catenin (S33Y) was amplified from pcDNA3-S33Y b-catenin (Addgene, MA, USA), and cloned between the XbaI and BamHI sites of plvx-IRES-zsGreen (Clontech Laboratories, CA, USA). The plasmid construction was verified by DNA sequencing. The mutant plasmid and blank vector were transiently transfected into HCT116 cells at 70% confluence in accordance with manufacturer’s instruction of LipoFectamine Plus Reagent (Invitrogen, Carlsbad, CA). After 24 hrs post transfection, cells were incubated with indicated dosage of COL for further assay.
+ Open protocol
+ Expand
9

Validating miR-630 Target Genes

Check if the same lab product or an alternative is used in the 5 most similar protocols
To validate the candidate target genes predicted by bioinformatics analysis are targets of miR-630, 3′UTRs of ARFGEF2, PDGFRA, SET, MTDH and EP300 containing the miR-630 binding site were amplified from the human genomic DNA using primers ARFGEF2-UTR-F/R, PDGFRA-UTR-F/R, SET-UTR-F/R, MTDH-UTR-F/R, severally (Supplementary Table S1), and then were cloned into the downstream of Renilla luciferase gene in the psiCHECK™-2 vector (Promega). Mutant MTDH-UTR plasmid containing three mutated bases on the predicted binding site was constructed using the fast mutagenesis kit (Vazyme) with primers MTDH-UTR-mut-F/R.
To stably overexpress mature miR-630 in MDA-231-D3H2LN cells, the DNA fraction containing the mature sequence of miR-630 was amplified with primers miR-630-F/R (Supplementary Table S1) from the model plasmid pcDNATM6.2-GWSW/miR-630 kindly provided by Prof, Min-Liang Kuo (National Taiwan University) and then was cloned into the lentiviral expression plasmid pLVX-IRESZsGreen (Clontech Laboratories). The pcDNA3.1-MTDH plasmid was structured previously in our lab [25 (link)].
For co-expression of microRNA mimics and its target-genes, the target-gene MTDH was transfected using Hily Max (Dojindo, Kumamoto, Japan) firstly, and after 24 hours the microRNA mimics were transfected using Lipofectamine 2000 reagent (Invitrogen).
+ Open protocol
+ Expand
10

Validation of miR-494 Target Genes

Check if the same lab product or an alternative is used in the 5 most similar protocols
To confirm the possibility of miR-494 targeting predicted candidate gene, 3′UTR of APC, Rab5A and PAK1 containing miR-494 binding site were cloned into the downstream of Renilla luciferase gene in the psiCHECK-2 vector (Promega). Mutant PAK1-3′UTR containing single mutated base and double mutated base sites were constructed using fast mutagenesis kit (Vazyme, shanghai, China). For PAK1 overexpressing, PAK1 was cloned into the pcDNA3.1. And pri-494 was cloned into the lentiviral expression plasmid pLVX-IRES-ZSGreen (Clontech Laboratories, CA, USA) for miR-494 stable overexpressing.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!