The largest database of trusted experimental protocols

13 protocols using prestige antibody

1

Immunohistochemical Analysis of BCL6 and RUVBL1

Check if the same lab product or an alternative is used in the 5 most similar protocols
Under an Institutional Review Board-approved protocol we obtained human paraffin-embedded tissues from the Surgical Pathology archives. Sections from the same block (not necessarily consecutive sections) were stained with various antibodies. BCL6 staining was performed as previously described [16] (link), [17] , [18] (link) with mouse monoclonal anti-human BCL6 (#M7211, DAKO or clone LN22, Novocastra). After antigen retrieval for 40 min in a 98° C waterbath with pH 6 antigen retrieval buffer (DAKO), staining for RUVBL1 was carried out overnight with an affinity purified Prestige antibody produced in rabbit (Sigma-Aldrich, St. Louis, MO, #HPA019947) that was diluted 1:265 to 1:350. Antigen-antibody binding was detected with DAB chromogen. Tissues were counterstained with hematoxylin. Appropriate positive and negative controls were used, including a negative isotype-matched control.
+ Open protocol
+ Expand
2

Western Blot Analysis of Brain Proteins

Check if the same lab product or an alternative is used in the 5 most similar protocols
Brain tissues were homogenized and lysed in SDS-Lysis buffer and western blotting was performed using a protocol described in our previous work (Singh et al., 2012 (link)). Samples (50 μg protein) were blotted using antibodies against GATA1 (ab28839, Abcam; 1:500 in 5% BSA), NRXN2 (ABN97, Milipore; 1:400 in 5% BSA), CAMK2A (Prestige Antibody, Sigma, 1:300 in 5% BSA), and β-ACTIN (sc47778, SantaCruz; 1:1000 in 5% BSA).
+ Open protocol
+ Expand
3

Immunohistochemical Analysis of MOSPD2 Expression

Check if the same lab product or an alternative is used in the 5 most similar protocols
To assess the prevalence of MOSPD2, tissue arrays of multiple organ tumor tissue and normal tissue MC6163, and normal tissue and breast cancer T088B and BR2082a tumor microarrays (US Biomax Rockville, MD) were stained with validated rabbit anti‐MOSPD2 Prestige antibody® (1:80, Sigma) or control rabbit antibody (R&D Systems) for 40 min, after which an ultraView Universal DAB Detection Kit (Ventana Medical Systems, 760‐500) was applied. MOSPD2 abundance was scored according to Junttila et al.15 who defined semi‐quantitative IHC scores on a scale of 0–3, where 0 means no staining, 1 is weak, 2 is moderate and 3 is strong staining. When heterogeneous staining within a single core was observed, the score referred to the area with the highest coverage. Scoring was performed by two individual scientists in a blinded fashion.
+ Open protocol
+ Expand
4

Immunohistochemical Analysis of BCL6 and RUVBL1

Check if the same lab product or an alternative is used in the 5 most similar protocols
Under an Institutional Review Board-approved protocol we obtained human paraffin-embedded tissues from the Surgical Pathology archives. Sections from the same block (not necessarily consecutive sections) were stained with various antibodies. BCL6 staining was performed as previously described [16 (link)-18 (link)] with mouse monoclonal anti-human BCL6 (#M7211, DAKO or clone LN22, Novocastra). After antigen retrieval for 40 min in a 98° C waterbath with pH 6 antigen retrieval buffer (DAKO), staining for RUVBL1 was carried out overnight with an affinity purified Prestige antibody produced in rabbit (Sigma-Aldrich, St. Louis, MO, #HPA019947) that was diluted 1:265 to 1:350. Antigen-antibody binding was detected with DAB chromogen. Tissues were counterstained with hematoxylin. Appropriate positive and negative controls were used, including a negative isotype-matched control.
+ Open protocol
+ Expand
5

Antibodies for GWL and Phospho-ENSA/ARPP19

Check if the same lab product or an alternative is used in the 5 most similar protocols
Polyclonal rabbit anti-GWL antibodies were generated and purified by Eurogentec. Mouse anti-Flag M2, rabbit [Prestige Antibodies] and mouse (RIPLY 74C) anti-MASTL (GWL) antibodies were purchased from Sigma-Aldrich and Abcam respectively. Polyclonal rabbit anti-phospho(Ser67)-ENSA/ARPP19 antibody was generated by Generon. Secondary antibodies were HRP-conjugated, polyclonal goat-derived antibodies against mouse and rabbit [Dako, Agilent Technologies].
+ Open protocol
+ Expand
6

Western Blot Protein Detection

Check if the same lab product or an alternative is used in the 5 most similar protocols
Protein extracts were loaded into 4–20% or 10% Mini-PROTEAN TGX Precast Protein Gels (Bio-Rad, 4561096). Then, it was transferred to polyvinylidene difluoride PVDF membrane for 30 min at 15 V using a semi-dry electrophoretic transfer cell (Bio-Rad, Watford, UK). Blots were probed with the recommended concentration of primary Ab (1:500–1:1000) except for FLYWCH1 (1:200) was used (Prestige Antibodies, Sigma-Aldrich, Gillingham, UK, HPA041001). As suitable, antibodies against β-actin or β-tubulin were used as a loading control.
+ Open protocol
+ Expand
7

Fis1 Protein Characterization Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
We used the rabbit anti-Fis1 antibody against the N-terminal cytoplasmic facing side of the human Fis1 protein, made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
+ Open protocol
+ Expand
8

Immunohistochemical Analysis of ICAM-1 Expression

Check if the same lab product or an alternative is used in the 5 most similar protocols
Progression tissue microarray (TMA) slides were provided by the NCI CDP and included 98 benign nevi, 73 primary tumors, and 41 lymph node metastases and 72 metastases from other locations. Other investigators may have received slides from these same array blocks. Immunohistochemical staining was performed on the TMA samples using a commercially available polyclonal rabbit anti-ICAM-1 antibody (Prestige Antibodies, Sigma Aldrich, Rehovot, Israel) according to standard procedures. A blinded assessment of ICAM-1 expression was conducted by an expert pathologist (IB). For each sample, intensity of ICAM-1 membrane expression was scored as none, low intensity, intermediate or high. Digital images were captured with Olympus BX51 microscope.
+ Open protocol
+ Expand
9

SIRT7 Expression in Prostate Cancer

Check if the same lab product or an alternative is used in the 5 most similar protocols
We prospectively collected clinical and pathological data from consecutive consenting patients undergoing radical prostatectomy for prostate cancer between 2014 and 2015. Surgical specimens underwent conventional histological processing and examination according to the Stanford protocol. Additionally, in each tissue section, areas of adenocarcinoma were identified and graded according to Gleason Score. Then, the Index lesion corresponding to the highest Gleason Score was studied by immunohistochemistry, using anti-SIRT7 antibody (Prestige Antibodies®, SIGMA-ALDRICH®). SIRT7 expression was analyzed in a qualitative manner by evaluating positivity or negativity of expression, comparing healthy and tumor areas, and in a quantitative manner. To quantify the expression of SIRT7 we used the Allred Score (0 to 8) [10 (link)] obtained by adding proportion of staining tumor (0 to 5) and signal intensity (0 to 3). The quantification was done by determining the average intensity and proportion of nuclei labelled including the nucleolus.
In each index lesion, the Allred Score and Gleason Score were compared using the Student t test (significance with p < 0.05). The analysis was performed blindly by two independent investigators.
+ Open protocol
+ Expand
10

Protein Expression Analysis by Western Blot

Check if the same lab product or an alternative is used in the 5 most similar protocols
Whole cell extracts were separated by 8% SDS-PAGE, transferred to polyvinylidene difluoride (PVDF) membrane and probed with anti–AURKA (C4718T, 1:1000, Cell Signaling Technology); anti-CCNA2 (H432, 1:1000, Santa Cruz Biotechnology); anti-CCNB1 (ab72, 1:1500, Abcam); anti-IDH1 (8137S, 1:1000, Cell Signaling Technology); anti-PHGDH (13428S,1:1000, Cell Signaling Technology); anti-PKM (3190S, 1:1000, Cell Signaling Technology); anti-TOP2B (HPA024120, 1:250, Prestige antibodies, Sigma); anti-TUB (T6074,1:400000, Sigma) at 4°C, overnight. 12.5% gels were used similarly and probed with anti-Total H3 (ab1791, 1:5000, Abcam); anti-phosphoH3 (ab5176, 1:1000, Abcam). Secondary antibodies, donkey-anti-mouse (715-035-151, 1:10000, Jackson ImmunoResearch Laboratories) or anti-rabbit (711-035-152, 1:10000, Jackson ImmunoResearch Laboratories) were conjugated to horseradish peroxidase antibodies and incubated for 1 h at room temperature. Blots were visualized with the Pierce ECL Western blotting substrate (34087, Thermo Scientific) according to manufacturer’s instructions.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!