Anti glial fibrillary acidic protein monoclonal antibody

The mimetic peptides gap19 (KQIEIKKFK, intracellular loop domain of Cx43), TAT-L2 (YGRKKRRQRRRDGANVDMHLKQIEIKKFKYGIEEHGK, second intracellular loop domain of Cx43) and ¹⁰panx1 (WRQAAFVDSY, first extracellular loop domain of Panx1) were obtained from GenScript (Piscataway Township, NJ, USA). Ethanol was obtained from Merck Millipore (Darmstadt, Germany). HEPES, ns-398, sc-560, L-N6, SB203580, lanthanum (La³⁺), anti-glial fibrillary acidic protein (GFAP) monoclonal antibody, BAPTA-AM, carbenoxolone (CBX), ethidium (Etd) bromide and probenecid were purchased from Sigma-Aldrich (St. Louis, MO, USA). Goat anti-mouse Alexa Fluor 488/555 and Hoechst 33342 were obtained from Thermo Fisher (Waltham, MA, USA). Normal goat serum (NGS) was purchased from Zymed (San Francisco, CA, USA).

A goat anti-cathepsin D antiserum was purchased from Santa Cruz Biotechnology (sc-6487 Dallas, USA). Rabbit anti-prosaposin antiserum was kindly provided by Dr Morales (Mc Gill University, Montreal, Canada) (Lefrancois et al., 2003 (link)). The rabbit anti-LAMP-1 (ab-24170) antiserum and anti-tubulin monoclonal antibody (ab-56676) were obtained from Abcam (USA), anti-Glial-Fibrillary Acidic Protein (GFAP) monoclonal antibody produced in mouse was obtained from Sigma-Aldrich (G-3893, USA). HRP-conjugated anti-goat IgG antiserum was obtained from H&L (401515), the HRP-conjugated anti-rabbit IgG fraction of antiserum was obtained from Sigma-Aldrich (A 9169) and anti-mouse IgG (whole molecule)-peroxidase was purchased from Sigma-Aldrich (A 9044). Chemiluminescent reagents were obtained from Pearce (Rockford, USA).