The largest database of trusted experimental protocols

Immulon 2hb 96 well microtiter plates

Manufactured by Thermo Fisher Scientific

Immulon 2HB 96-well microtiter plates are a type of laboratory equipment used for various applications in life science research and diagnostics. They provide a standardized 96-well format for conducting assays and experiments. The plates are made of high-quality polystyrene material and have a high-binding surface, making them suitable for a range of immunological and biochemical assays.

Automatically generated - may contain errors

3 protocols using immulon 2hb 96 well microtiter plates

1

Cervid PrP Antibody Quantification

Check if the same lab product or an alternative is used in the 5 most similar protocols
IgG, IgM and IgA serum antibody levels to recombinant cervid PrP were determined by a 1:125 dilution of plasma in duplicate, in which 50 μl/well of 1.5 μg/ml cervid recPrP in 50 mM ammonium bicarbonate pH 9.6 was coated at 4°C overnight onto Immulon 2HB 96 well microtiter plates (Thermo Scientific). Bound antibodies were detected by a goat anti-deer IgG, linked to horseradish peroxidase (HRP) (KPL, Gaithersburg, MD) and rabbit anti-goat or anti sheep IgM or IgA linked to HRP (Bethyl Lab. Inc., Montgomery, TX ). The color was developed by 3,3′,5,5′-tetramethylbenzidine (Pierce Biotech. Inc., Rockford, IL) as substrate; the reaction was stopped by 2N sulfuric acid and the plates read at 450nm in an ELISA reader. No commercially available anti-deer IgA or IgM exists; thus, both anti-goat and anti-sheep were used because they gave the best cross-reactivity with cervid Ig. Saliva samples were tested at 1:20 for IgM and IgA using a similar ELISA.
In the feces supernatant extract, IgA levels to recPrP were determined in a 1:30 dilution of the extract in PBST, using the above protocol.
+ Open protocol
+ Expand
2

ELISA-Based Antibody Titer Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols
Each mouse was bled 3 weeks after the 1st and 2nd immunizations and 2 weeks after the 3rd immunization. Sera were used to analyze antibody titers by ELISA. Full-length CSP (100 ng/well), NANPx6-C peptide (100 ng/well), Pf16 a biotinylated C-terminal peptide (EPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCS [100 ng/well]), or purified Hepatitis B S antigen supplied by GSK (100 ng/well) in PBS were coated on Immulon 2HB 96-well microtiter plates (Thermo Scientific, Rochester, NY). For ELISA59 (link), plates were coated overnight at 4 °C and blocked the next day for 1 h with 1% casein in PBS. Serum was serially diluted and added to the plate for 2 h at room temperature. Secondary antibody anti-mouse IgG HRP (Southern Biotech, Birmingham, AL) was then added for 1 h. Plates were developed with ABTS peroxidase substrate system (KPL, Gaithersburg, MD) for 1 h, and the reaction was stopped with a final 2.5% concentration of sodium dodecyl sulfate. Washes between each step were performed with PBS + 0.05% Tween20. Titer was calculated as the dilution that resulted in OD415 = 1.0 using Gen5 4-parameter nonlinear regression (BioTek, Winooski, VT).
+ Open protocol
+ Expand
3

ELISA for M. tuberculosis Antibodies

Check if the same lab product or an alternative is used in the 5 most similar protocols
Immulon 2HB 96-well microtiter plates (Thermo Lab Systems) were coated with 0.1 μg of recombinant M. tuberculosis antigen 85A or 85B proteins (BEI Resources) and incubated at 4°C overnight. Assays were performed according to the manufacturer’s instructions (KPL). Serial dilutions of serum samples from mice were added onto the antigen-coated plates. Goat anti-mouse IgG conjugated to HRP (KPL) was added, and the plates were developed. The optical density (OD) was measured at 450 nm with a Bio-Tek Powerwave XS plate reader. The IgG titer was determined to be the lowest serum dilution with an OD greater than that of the mean of naive serum plus two standard deviations.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!