Log In Sign up
The largest database of trusted experimental protocols

Cantharidin

Manufactured by Bio-Techne
Visit Supplier

Cantharidin is a chemical compound that can be used as a lab equipment in research applications. It is a naturally occurring substance found in certain species of blister beetles. Cantharidin has a specific chemical structure and physical properties that make it useful for various research and experimental purposes.

Automatically generated - may contain errors

Lab products found in correlation

Carboplatin, by Teva Pharmaceuticals (2 mentions) Etoposide, by Fresenius (2 mentions) Lb 100, by Selleck Chemicals (2 mentions) Biological reagents, by Merck Group (2 mentions) Heparin, by Merck Group (1 mentions) Difmup, by Thermo Fisher Scientific (1 mentions) Fgf18, by Thermo Fisher Scientific (1 mentions) Dea no, by Cayman Chemical (1 mentions) Forskolin, by Bio-Techne (1 mentions) Okadaic acid, by Bio-Techne (1 mentions) Rolipram, by Bio-Techne (1 mentions) Gabazine, by Bio-Techne (1 mentions) Skf38393 hydrobromide, by Bio-Techne (1 mentions) Roscovitine, by Bio-Techne (1 mentions) Cgs 21680 hydrochloride, by Bio-Techne (1 mentions) 8 br camp, by Bio-Techne (1 mentions)

5 protocols using cantharidin

1

Biological Reagents and Treatments

Check if the same lab product or an alternative is used in the 5 most similar protocols
Biological reagents were purchased from Sigma-Aldrich (St. Louise, MO) or Thermo Fisher Scientific (Waltham, MA). Electrophoresis and western blotting reagents were purchased from Bio-Rad (Irvine, CA). LB100 was purchased from SelleckChem (Houston, TX), cantharidin from Tocris (Minneapolis, MN), carboplatin was purchased from Teva Pharmaceuticals (Irvine, CA) and etoposide was purchased from Fresenius Kabi (Schaumburg, IL).
Mirzapoiazova T., Xiao G., Mambetsariev B., Nasser M.W., Miaou E., Singhal S.S., Srivastava S., Mambetsariev I., Nelson M.S., Nam A., Behal A., Atri P., Muschen M., Tissot F.L., Miser J., Kovach J.S., Sattler M., Batra S.K., Kulkarni P, & Salgia R. (2021). Protein Phosphatase 2A as a Therapeutic Target in Small Cell Lung Cancer. Molecular Cancer Therapeutics, 20(10), 1820-1835.
+ Open protocol
+ Expand
2

Synthesis and Validation of BMN-111 Peptide

Check if the same lab product or an alternative is used in the 5 most similar protocols
CNP and ANP were obtained from Phoenix Pharmaceutical (catalogs 012-03 and 005-24, respectively). BMN-111 was synthesized by New England Peptide as a custom order with the following sequence: (Cyc[23,39])H2N-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH, as previously described (32 (link)). The purity was > 95%. DEA/NO was from Cayman Chemical (catalog 82100). LB-100 (3-[4-methylpiperazine-1-carbonyl]-7-oxabicyclo[2.2.1]heptane-2-carboxylic acid) was from Selleck Chemicals (catalog S7537) or MedChem Express (catalog HY-18597). Cantharidin was from Tocris (catalog 1548). FGF18 was from PeproTech (catalog 100-28), and heparin was from Sigma-Aldrich (catalog H4784). DiFMUP (6,8-Difluoro-4-methyl-7-[phosphonooxy]-2H-1-benzopyran-2-one) was from Thermo Fisher Scientific (catalog D6567).
Shuhaibar L.C., Kaci N., Egbert J.R., Horville T., Loisay L., Vigone G., Uliasz T.F., Dambroise E., Swingle M.R., Honkanen R.E., Duplan M.B., Jaffe L.A, & Legeai-Mallet L. (2021). Phosphatase inhibition by LB-100 enhances BMN-111 stimulation of bone growth. JCI Insight, 6(9), e141426.
+ Open protocol
+ Expand
3

Optimization of Cell Signaling Inhibitors

Check if the same lab product or an alternative is used in the 5 most similar protocols
Biological reagents were purchased from Sigma-Aldrich or Thermo Fisher Scientific. Electrophoresis and Western blotting reagents were purchased from Bio-Rad. LB100 was purchased from SelleckChem, cantharidin from Tocris, carboplatin was purchased from Teva Pharmaceuticals, and etoposide was purchased from Fresenius Kabi.
Mirzapoiazova T., Xiao G., Mambetsariev B., Nasser M.W., Miaou E., Singhal S.S., Srivastava S., Mambetsariev I., Nelson M.S., Nam A., Behal A., Atri P., Muschen M., Tissot F.L., Miser J., Kovach J.S., Sattler M., Batra S.K., Kulkarni P, & Salgia R. (2021). Protein Phosphatase 2A as a Therapeutic Target in Small Cell Lung Cancer. Molecular Cancer Therapeutics, 20(10), 1820-1835.
+ Open protocol
+ Expand
4

Pharmacological Reagents for Neuroscience Research

Check if the same lab product or an alternative is used in the 5 most similar protocols
SKF-38393 hydrobromide, CGS 21680 hydrochloride, 1-methyl-3-isobutylxanthine (IBMX), rolipram, papaverine, roscovitine, okadaic acid, cantharidin, gabazine, CNQX, APV, and forskolin were obtained from Tocris Cookson. TTX was from Latoxan. PQ-10, MP-10, and roflumilast were a gift from Janssen Pharmaceuticals. TP-10 was provided by Pfizer through the Compound Transfer Program.
Polito M., Guiot E., Gangarossa G., Longueville S., Doulazmi M., Valjent E., Hervé D., Girault J.A., Paupardin-Tritsch D., Castro L.R, & Vincent P. (2015). Selective Effects of PDE10A Inhibitors on Striatopallidal Neurons Require Phosphatase Inhibition by DARPP-32,,. eNeuro, 2(4), ENEURO.0060-15.2015.
+ Open protocol
+ Expand
5

Modulating Endogenous PKA and PP2A in SCLC

Check if the same lab product or an alternative is used in the 5 most similar protocols
For stimulation or inhibition of endogenous PKA and PP2A, SCLC cells were plated overnight in media containing 2% BGS. The following day 100 μM 8-Br-cAMP (Tocris), 20 μM H89 (Tocris), 10 μM cantharidin (Tocris), or 10 μM SMAP-1154 were added to cells in media containing 2% BGS for 60 min or as described in the figure legends. The Prkaca knockdown studies, all cell viability assays, and immunoblots/immunoassays were also performed in media containing 2% BGS.
Coles G.L., Cristea S., Webber J.T., Levin R.S., Moss S.M., He A., Sangodkar J., Hwang Y.C., Arand J., Drainas A.P., Mooney N.A., Demeter J., Spradlin J.N., Mauch B., Le V., Shue Y.T., Ko J.H., Lee M.C., Kong C., Nomura D.K., Ohlmeyer M., Swaney D.L., Jackson P.K., Narla G., Gordan J.D., Shokat K, & Sage J. (2020). UNBIASED PROTEOMIC PROFILING UNCOVERS A TARGETABLE GNAS/PKA/PP2A AXIS IN SMALL CELL LUNG CANCER STEM CELLS. Cancer cell, 38(1), 129-143.e7.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!