The largest database of trusted experimental protocols

6 protocols using anti ha matrix

1

Tandem Immunoprecipitation of TLR9 Complexes

Check if the same lab product or an alternative is used in the 5 most similar protocols
Cardiomyocytes or fibroblasts transfected with adenovirus expressing HA-FLAG-tagged TLR9 or YFP were lysed in lysis buffer (20 mM MOPS, pH 7.4, 10% glycerol, 0.15 M NaCl, 0.5% 3-[(3-Cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS), 1 mM EDTA, protease inhibitor cocktail (Sigma)) and immunoprecipitated with anti-FLAG M2 agarose (Sigma) at 4°C for 1 h. The beads were washed and eluted with buffer containing 0.25 mg/ml 3 × FLAG peptide (Sigma) at 4°C for 15 min. After removal of the FLAG-agarose, the eluates were immunoprecipitated with anti-HA matrix (Roche, clone 12CA5) at 4°C overnight. HA matrix was washed with lysis buffer followed by another wash with buffer containing 1 M NaCl and then eluted with 0.1 M glycine-HCl (pH 2.4) at room temperature for 10 min.
+ Open protocol
+ Expand
2

Antibody Generation and Western Blot

Check if the same lab product or an alternative is used in the 5 most similar protocols
As previously described, rabbit polyclonal anti-Nck1 antibody was generated using GST-fusion protein encoding human Nck1-specific amino acid sequences between the third SH3 and the SH2 domains (Nck1: QNNPLTSGLEPSPPQCDYIRPSLTGKFAGNP) [24 (link)]. Rabbit polyclonal anti-p85 antibody was generated using GST-fusion protein encoding the two SH2 domains of the p85 subunit of PI3K. pAkt (Ser473 and Thr308), Akt, FoxO1, β-Actin and HSP90 antibodies were purchased from Cell Signaling Technology. pY20 antibody was purchased from Santa Cruz Biotechnology, PTP1B antibody from BD Biosciences, anti-HA matrix from Roche, while FLAG antibodies was from Sigma.
+ Open protocol
+ Expand
3

Affinity Purification of Protein Complexes

Check if the same lab product or an alternative is used in the 5 most similar protocols
Cell lysates from HEK293T cells were collected and lysed in the triton lysis buffer: 10 mM Tris-HCl pH 8.0, 2.5 mM MgCl2, 5 mM EGTA pH 8.0, 0.5% Triton X-100 (w/v), 1 mM Na3VO4, 50 mM NaF and 1 tablet of protease inhibitor cocktail (Roche) per 10 ml of buffer. Anti-Flag M2 magnetic beads (Sigma) were used to isolate co-immunoprecipitated complex with Flag-tagged proteins, and Anti-HA matrix (Roche) were used to isolate co-immunoprecipitated complex with HA-tagged proteins. Beads and matrix were washed following manufacturer’s instruction.
+ Open protocol
+ Expand
4

Affinity Purification and Mass Spectrometry of HA-Tagged Proteins

Check if the same lab product or an alternative is used in the 5 most similar protocols
HopW1-HA was immunoprecipitated with anti-HA matrix (Roche) from transgenic Arabidopsis or transiently transformed N. benthamiana as described Text S1. LC-MS/MS protein identification after trypsin digestion of protein bands was performed at Chicago Biomedical Consortium as described [47] (link); data was searched against the NCBI database using Mascot and validated with Scaffold 2 (Proteome Software Inc.)
+ Open protocol
+ Expand
5

Casp8p41-HA Expression and Protein Interactions

Check if the same lab product or an alternative is used in the 5 most similar protocols
Activated CD4 cells (as mentioned above) were transfected with Casp8p41-HA expression vector using Lanza Nucleofector IIb system. One hour after electroporation, cells were treated with Z-VAD-fmk (10 μM) and Ixazomib (100 nM) for 4 h (to prevent protein degradation and cell death induced by Casp8p41 expression), followed by treatment with or without bryostatin (10 ng/ml) for an additional 1 h. Cells were collected and washed and lysis with cell lysis buffer (20 mM Tris, pH 7.5, 150 mM NaCl, 1.0% Tween-20, protease and phosphatases inhibitors). Five hundred micrograms of total cell lysate were diluted in 500 μl of buffer, precleared with 25 μl Protein A/G agarose (Santa Cruz). Precleared lysate incubated with Anti-HA matrix (cat # 11815016001, Roche, Germany) or 2 μg anti–BCL2 (SC-509, Santa Cruz) or mouse IgG for overnight at 4C. After incubation, 20 μl of Protein A/G agarose was added to the appropriated samples, and complexes were washed five times in IP buffer (20 mM Tris, pH 7.5, 300 mM NaCl, 1.0% Tween-20, protease and phosphatases inhibitors) and boiled in 20 μl 2× SDS-PAGE loading buffer, subjected to SDS-PAGE, and immunoblotted with HA-HRP antibody (Roche) or BCL2 antibody.
+ Open protocol
+ Expand
6

Immunoprecipitation of Flag- and HA-tagged Proteins

Check if the same lab product or an alternative is used in the 5 most similar protocols
IP protocol was previously described93 (link). Protein lysates (1 mg per 1 ml) were suspended in 1 ml of lysis buffer containing a protease inhibitor cocktail and incubated with 20 µL anti-Flag matrix (Sigma, A2220) or anti-HA matrix (Roche, 11815016001) overnight at 4 °C with end-over-end rotation. Unbound proteins were removed by washing 4 times with 1 ml of lysis buffer and with spinning at 2500 rcf for 1 min each time. Precipitated proteins were denatured in 2× reducing SDS-PAGE sample buffer and boiled for 5 min at 95 °C.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!