Whatman filter paper #1 was purchased from GE Healthcare Life Sciences. Wax paper squares (6″) were purchased from NORPRO. Gold (III) chloride hydrate, sodium citrate tribasic, poly (ethylene glycol) 2-mercaptoethyl ether acetic acid (thiol-PEG-acid) 2100, N-hydroxysulfosuccinimide sodium salt (sulfo-NHS), N-(3-Dimethylaminopropyl)-N′- ethylcarbodiimide hydrochloride (EDAC; EDC), poly (sodium 4-styrenesulfonate, average Mw ∼70.000) 30 % solution, polyethylene glycol 3000 (biotin-PEG), Tween-20, 2-ethanesulfonic acid (MES), and anti-mouse IgG (Fc Specific) (SAB3701021) were obtained from Sigma Aldrich. Mouse monoclonal antibody Anti-SARS-CoV-2 N-protein (35–579) was purchased from ProScience. Recombinant Nucleocapsid protein from SARS-CoV-2 (230−01104) was purchased from Raybiotech. Bovine serum albumin (BSA, protease free) was purchased from VWR chemicals. Aerosol bottles were purchased from Lurrose. Surgical facemasks for experiments in Fig. 3 were purchased from Medline (NONE27377). PBS refers to phosphate buffered saline pH 7.4. PBST refers to PBS supplemented with 0.1 % Tween-20. RT refers to room temperature. PBS-BSA refers to PBS supplemented with 0.5 % BSA.
Sodium citrate tribasic
Manufactured by Merck Group
Sourced in United States
Sodium citrate tribasic is a chemical compound commonly used as a laboratory reagent. It is a salt of citric acid, with the chemical formula Na3C6H5O7. Sodium citrate tribasic is a white, crystalline powder that is soluble in water and has a slightly alkaline pH. It is commonly used as a buffer, chelating agent, and anticoagulant in various laboratory applications.
Automatically generated - may contain errors
Lab products found in correlation
Sodium hydroxide (naoh), by Merck Group (3 mentions)
Whatman 1 filter paper, by GE Healthcare (1 mentions)
2 ethanesulfonic acid mes, by Merck Group (1 mentions)
Gold 3 chloride hydrate, by Merck Group (1 mentions)
Whatman, by Cytiva (1 mentions)
Sodium dodecyl sulfate (sds), by Merck Group (1 mentions)
Kh2po4, by Merck Group (1 mentions)
Nah2po4, by Merck Group (1 mentions)
Na2hpo4, by Merck Group (1 mentions)
Haucl4, by Merck Group (1 mentions)
2 2 azobisisobutyronitrile aibn, by Merck Group (1 mentions)
Dopamine hydrochloride, by Merck Group (1 mentions)
Fluorobenzene, by Merck Group (1 mentions)
1 hexylamine, by Merck Group (1 mentions)
Dulbecco s modified eagle s medium dmem, by Merck Group (1 mentions)
Fetal bovine serum (fbs), by Thermo Fisher Scientific (1 mentions)
Tannic acid, by Merck Group (1 mentions)
Hydroquinone, by Merck Group (1 mentions)
4 6 diamidino 2 phenylindole (dapi), by Dojindo Laboratories (1 mentions)
Gold 3 chloride haucl4, by Merck Group (1 mentions)
16 protocols using sodium citrate tribasic
1
Development of SARS-CoV-2 Antigen Assay
2
Intracellular Retention and Proliferation of Contrast Agents
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
To quantify the intracellular retention of contrast agents and the effect on cellular proliferation, labelled cells were trypsinised after labelling and counted using an automated cell counter (TC20, Biorad). A fraction of the cells (5×104) was plated in 24-well plates in triplicate and allowed to grow for up to 3 days. At 24 h intervals, the cells from one of the wells were trypsinised, counted using the trypan blue exclusion assay and then used for intracellular iron quantification.
To evaluate the long-term stability of the particles, a lysosomal model of cellular digestion as originally proposed by Skotland et al.[12] was used. The pH of PBS containing 22 mM sodium citrate tribasic (Sigma) was left at 7.2 or adjusted to 5.5 or 4.5 using hydrochloric acid. A sample containing 1 µg of particles (Fe basis) was added to these buffers and allowed to digest for a period of up to 28 days at 37°C. The amount of dissolved iron was quantified using the ferrozine assay as described above using a slightly modified ferrozine reagent consisting of 6.5 mM Ferrozine, 100 mM L-ascorbic acid and 1.1 M ammonium acetate.
To evaluate the long-term stability of the particles, a lysosomal model of cellular digestion as originally proposed by Skotland et al.[12] was used. The pH of PBS containing 22 mM sodium citrate tribasic (Sigma) was left at 7.2 or adjusted to 5.5 or 4.5 using hydrochloric acid. A sample containing 1 µg of particles (Fe basis) was added to these buffers and allowed to digest for a period of up to 28 days at 37°C. The amount of dissolved iron was quantified using the ferrozine assay as described above using a slightly modified ferrozine reagent consisting of 6.5 mM Ferrozine, 100 mM L-ascorbic acid and 1.1 M ammonium acetate.
3
Functionalized Oligonucleotide Probe Protocol
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Gold (III) chloride hydrate, HAuCl4 (Sigma, USA); Sodium citrate tribasic (Sigma); Tris (2-carboxyethyl)- phosphine, TCEP (Sigma); Sodium Chloride, NaCl (SRL); Sodium dodecyl sulphate, SDS (Sigma); disodium hydrogen phosphate, Na2HPO4 (Merck, Germany); sodium dihydrogen phosphate, NaH2PO4 (Merck); sodium hydroxide, NaOH (SRL, India); potassium dihydrogen phosphate, KH2PO4 (Merck). All the chemical solutions and buffers were prepared using sterile double distilled water (ddH2O).
Sequences for thiol-modified oligonucleotide probe and complimentary sequence were as follows and custom synthesized:
BCSP31 probe—5’SH–(CH2)9GGGCAAGGTGGAAGATTTGCGCCT-3’ BCSP31complementary—5’-AGGCGCAAATCTTCCACCTTGCCC-3’
Sequences for thiol-modified oligonucleotide probe and complimentary sequence were as follows and custom synthesized:
BCSP31 probe—
4
Synthesis and Characterization of Functionalized Polymers
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Dopamine hydrochloride (99%, DA), 2,3-dichloromaleic anhydride (97%), 1-hexylamine (99%), sodium citrate tribasic (≥99%), and fluorobenzene were purchased from Sigma-Aldrich (Sydney, Australia) and used as received without any further purification. Silver nitrate and triethylamine (TEA) were purchased from Univar (Sydney, Australia) and also used as received. 2,2′-azobis(isobutyronitrile) (AIBN, Sigma-Aldrich, 97%) was purified by recrystallization from cold methanol prior to use. Pentafluorostyrene (PFS, Oakwood Products, 99%) was passed through a column of activated basic alumina prior to use to remove inhibitor. 4-cyanopentanoic acid dithiobenzoate (CPADB) was synthesized as described in the literature [22 (link)]. 1-thio-β-ᴅ-glucose sodium salt (GluSNa) was prepared from 1-thio-β-ᴅ-glucose tetraacetate (AcO-GluSH) according to literature method [23 (link)]. All solvents were laboratory reagent grade and used as received without any further purification.
5
Synthesis and Characterization of Gold Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Gold (III) chloride (HAuCl4), sodium citrate tribasic, tannic acid, potassium carbonate, Bis(p-sulfonatophenyl)phenylphosphine dihydrate dipotassium salt (BSPP), hydroquinone, and Dulbecco’s modified Eagle’s medium (DMEM) were purchased from Sigma-Aldrich (St. Louis, MO, USA). Tween 20 was purchased from Tokyo Chemical Industry (Tokyo, Japan). Thiol-terminated metoxypolyethylene glycol (PEG-SH) (Sunbright ME-050SH, MW = 5 kDa) was purchased from NOF Corp. (Tokyo, Japan). Sonazoid was purchased from Daiichi Sankyo Co. Ltd. (Tokyo, Japan). bEND.3 mouse brain endothelial cell was provided by the RIKEN cell bank. Penicillin–streptomycin-amphotericin B and 20% formalin were purchased from Wako Pure Chemical Industries (Osaka, Japan). Fetal bovine serum (FBS) and ZO-1 rabbit polyclonal antibodies were purchased from Thermo Fisher Scientific Inc. (Waltham, MA, USA). TRITC-conjugated anti-rabbit IgG was purchased from Agilent Technologies Inc. (Santa Clara, CA, USA). DAPI was purchased from Dojindo (Kumamoto, Japan). A silver enhancement kit was purchased from BBI Solutions (Crumlin, UK).
6
Synthesis of Stable Silver Nanoprisms
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Silver nanoprisms were prepared
by a chemical reduction method as previously described.41 ,44 Solutions were added to a 25 mL Erlenmeyer flask in the following
order: 2.0 mL of 12.4 mM sodium citrate tribasic (Sigma-Aldrich 99.0%),
5.0 mL of 0.375 mM silver nitrate (Sigma-Aldrich 99.9999%), and 5.0
mL of 50 mM hydrogen peroxide (Fisher Scientific). Then, 25 μL
of 1 mM potassium bromide (Fisher Scientific) was added using a micropipette.
Lastly, 2.5 mL of fresh 5 mM sodium borohydride (J.T. Baker 98%) was
added. The flask was covered and shaken to mix the reactants. After
formation of the nanoprisms, the solution of nanoprisms was blue in
color and stable for several weeks.
by a chemical reduction method as previously described.41 ,44 Solutions were added to a 25 mL Erlenmeyer flask in the following
order: 2.0 mL of 12.4 mM sodium citrate tribasic (Sigma-Aldrich 99.0%),
5.0 mL of 0.375 mM silver nitrate (Sigma-Aldrich 99.9999%), and 5.0
mL of 50 mM hydrogen peroxide (Fisher Scientific). Then, 25 μL
of 1 mM potassium bromide (Fisher Scientific) was added using a micropipette.
Lastly, 2.5 mL of fresh 5 mM sodium borohydride (J.T. Baker 98%) was
added. The flask was covered and shaken to mix the reactants. After
formation of the nanoprisms, the solution of nanoprisms was blue in
color and stable for several weeks.
7
Antioxidant and Phytochemical Assays
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
2,2´-Azobis (2-methylpropionamidine) dihydrochloride (ABTS), 2,2-diphenyl-1-6,6 picrylhydrazyl (DPPH), 2,2´-azino-bis (3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), ascorbic acid, Folin-Ciocalteu reagent (Merck Millipore, Darmstadt, Germany) . gallic acid and the anthocyanin standard (cyanidin chloride, delphinidin-3-O-glucoside, malvidin-3-Oglucoside, ≥ 95%) were purchased from chromadex. hemtoxylin, eosin and x ylene were procured from HiMedia laboratories, LLC. Biochemical and hematology analysis kits were purchased from Erba Mannheim, UK. Sodium citrate tribasic (anti-coagulant) was purchased from Sigma-Aldrich, St. Louis, Missouri, United States.
All the solvents for UPLC analysis were of HPLC grade. All the other chemicals used were of analytical grade.
All the solvents for UPLC analysis were of HPLC grade. All the other chemicals used were of analytical grade.
8
Synthesis of pHLIP® and Gold Nanoparticle
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Gold III chloride, 5% solution, was purchased from Salt Lake Metals (Salt Lake City, UT). Sodium citrate tribasic, L -ascorbic acid, and urea dehydrate were purchased from Sigma-Aldrich Co. (St. Louis, MO). The wild type (WT) pHLIP® peptide:
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET
was synthesized and purified by C.S. Bio Co. (Menlo Park, CA), and the concentration of the peptide was determined by absorbance at 280 nm (ε=13,940 M−1 cm−1). The m-polyethylene glycol–SH (mPEG-SH), about 5 kDa in mass, was purchased from Creative PEGworks (Chapel Hill, NC). The lipids, 1,2-dihexanoyl-sn-glycero-3-phosphocholine, D6PC; 1,2-diheptanoyl-sn-glycero-3-phosphocholine, D7PC/DHPC and 1,2-dimyristoyl-sn-glycero-3-phosphocholine, DMPC were purchased from Avanti Polar Lipids, Inc (Alabaster, AL). Tris-(2-carboxyethyl)phosphine hydrochloride (TCEP) was purchased from Thermo Fisher Scientific (Waltham, MA). The procedures for synthesis of the spherical and multispiked pHLIP® and PEG coated gold nanoparticle are described in the Results section.
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET
was synthesized and purified by C.S. Bio Co. (Menlo Park, CA), and the concentration of the peptide was determined by absorbance at 280 nm (ε=13,940 M−1 cm−1). The m-polyethylene glycol–SH (mPEG-SH), about 5 kDa in mass, was purchased from Creative PEGworks (Chapel Hill, NC). The lipids, 1,2-dihexanoyl-sn-glycero-3-phosphocholine, D6PC; 1,2-diheptanoyl-sn-glycero-3-phosphocholine, D7PC/DHPC and 1,2-dimyristoyl-sn-glycero-3-phosphocholine, DMPC were purchased from Avanti Polar Lipids, Inc (Alabaster, AL). Tris-(2-carboxyethyl)phosphine hydrochloride (TCEP) was purchased from Thermo Fisher Scientific (Waltham, MA). The procedures for synthesis of the spherical and multispiked pHLIP® and PEG coated gold nanoparticle are described in the Results section.
9
Colorimetric Detection of Food Dyes
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Gold(iii ) chloride (CAS#27988-77-8) and sodium citrate tribasic (CAS#6858-44-2) were purchased from Sigma-Aldrich (Shanghai, China). Nitric acid (CAS#7697-37-2) was bought from Sinopharm Chemical Reagent Co., Ltd (Shanghai, China). Rhodamine 6G (R6G) was obtained from (CAS#989-38-8) Sangon Biotech (Shanghai, China). The standard substances erythrosine (GBW(E)100163, CAS#16423-68-0), basic orange 2 (CAS#532-82-1), 21 (CAS#3056-93-7) and 22 (CAS#4657-00-5) were supplied by Bjhongmeng Co., Ltd (Beijing, China). Four types of beverages FDDR, FDDY, VCD and DPD are commercially available.
10
Immunoassay for 2-AG Quantification
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
A 2-AG kit consisted of biotinylated antibodies and various concentrations of the antigen was purchased from ZellBio GmbH (Germany) by Padgin Teb Company. K4Fe(CN)6, K3Fe(CN)6 and KCl were obtained from Merck. Hydroxysuccinimide (NHS)/N-1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC), hydrogen tetrachloroaurate(iii ) hydrate (HAuCl4·3H2O), sodium citrate tribasic (Na3C6H5O7), silver nitrate (AgNO3), sodium borohydride (NaBH4), ascorbic acid and cetyltrimethylammonium bromide (CTAB) were all obtained from Sigma-Aldrich (Ontario, Canada). The fresh frozen plasma samples were gained from the Iranian Blood Transfusion Research Center (Tabriz, Iran). Sample donors signed a written cosecant form approved by the ethics committee of Tabriz University of Medical Science (IR.NIMAD.REC.1400.059).
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!