The largest database of trusted experimental protocols

4 protocols using u1 snrnp 70

1

Comprehensive Antibody Characterization for Western Blotting, IPs, and Immunostaining

Check if the same lab product or an alternative is used in the 5 most similar protocols
Primary antibodies against the following proteins were utilized for western blotting, IPs, or immunostaining [listed in the format ‘protein name (catalog number, supplier)’]: DDX19A (ARP36455_T100, Aviva System Biology); DDX19B (ab70305, Abcam); lamin A/C (sc-376248, Santa Cruz Biotechnology); eIF4E (2067, Cell Signaling Technology); eIF3b (sc-16377, Santa Cruz Biotechnology), β-actin (A5441, Sigma); GAPDH (LF-PA0212, AbFrontier); FLAG (A8592 or F1804, Sigma); HA (11867431001, Roche); Myc (9E10; OP10L, Calbiochem); U1 snRNP 70 (sc-390899, Santa Cruz Biotechnology); CBP80, eIF4G1 and CTIF (6 (link)); and eIF4A3 (32 (link)).
+ Open protocol
+ Expand
2

Antibodies Used for IP and Western Blot

Check if the same lab product or an alternative is used in the 5 most similar protocols
Antibodies against the following proteins were used for IPs and Western blots: CBP80 (36 (link)), eIF4E (610269, BD Bioscience; 2067, Cell Signaling Technology), UPF1 (a gift from Lynne E. Maquat), phospho-(S/T)Q (2851, Cell Signaling Technology), UPF2 (36 (link)), STAU1 (A303–956A, Bethyl Laboratories), IMPα (A300–484A, Bethyl Laboratories), PABPN1 (A303–524A, Bethyl Laboratories), eIF4A3 [sc-365549, Santa Cruz Biotechnology; (36 (link))], Y14 (MAB2484, Abnova), p53 (2524, Cell Signaling Technology), phospho-Ser15-p53 (9284, Cell Signaling Technology), U1 snRNP70 (sc-390899, Santa Cruz Biotechnology), FLAG (A8592, MilliporeSigma), HA (11 867 431 001, Roche), Myc (OP10L, Calbiochem), β-actin (A5441, MilliporeSigma), and GAPDH (LF-PA0212, Ab Frontier). For IP of endogenous eIF4E, we employed an in-house anti-eIF4E antibody, which was raised in rabbits against a human eIF4E-specific peptide (MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH).
Signal intensities of Western blot bands were quantitated in the Image J software (version 1.5, National Institutes of Health).
+ Open protocol
+ Expand
3

Western Blotting Antibody Detection Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
Western blotting was performed as previously described (58 (link),59 (link)) using the following antibodies: Calreticulin, Cell Signaling 2891; Histone H3, abcam ab1791; U1 snRNP 70, Santa Cruz sc-390899; Pol-II, abcam ab5408; PABPC, abcam ab21060; PABPN, abcam ab75855; GAPDH proteintech 60004-1-Ig; Actin, MP Biomedicals 0869100-CF; Tubulin, Sigma T9026. Western blots were visualized using an Odyssey Fc imaging system (LI-COR).
+ Open protocol
+ Expand
4

Investigating FOXO3 and Bim1 Regulation in EGFR/HER Signaling

Check if the same lab product or an alternative is used in the 5 most similar protocols
Entinostat was provided by Syndax Pharmaceuticals, Inc. Lapatinib was purchased from ChemieTek. Small interfering RNA (siRNA) targeting FOXO3 and Bim1 were purchased from Sigma-Aldrich. The following antibodies were purchased from Cell Signaling Technology (Beverly, MA): pEGFR-Tyr1173, EGFR, pHER2-Tyr1248, HER2, pHER3-Tyr1289, HER3, pERK-Thr202/Tyr204, ERK, pAKT-Ser473, AKT, Bim1. We obtained β-actin (clone AC-15; Sigma-Aldrich, St Louis, MO), U1 snRNP70 (Santa Cruz Biotechnology, Santa Cruz, CA), Alexa Fluor 680 and 800 (Invitrogen, Carlsbad, CA), and horseradish peroxidase (HRP)-conjugated antibodies (Thermo Scientific, Rockford, IL). The following small interfering RNA oligos (Sigma-Aldrich) were used for depletion of FOXO3a or Bim1: FOXO3a #1, 5′CGAAUCAGCUGACGACAGU[dT][dT]3′; FOXO3a #2, 5′CGAUUCAUGCGGGUCCAGA[dT][dT]3′; FOXO3a #3, 5′GAAUGAGGGCUGACUGAA[dT][dT]3′; Bim1 #1, 5′GAAUGGUUAUCUUACGACU[dT][dT]3′; Bim1 #2, 5′CAGAUAUGCGCCCAGAGAU[dT][dT]3′; Bim1 #3, 5′CAUGAGUUGUGACAAAUCA[dT][dT]3′. Knockdown efficiency of single siRNAs was tested by Western blotting (Supplementary Fig. S1), and we used pooled siRNA of three target siRNAs for knockdown experiments. The scrambled siRNA was purchased from Thermo Scientific (ON-TARGETplus Non-targeting Control Pool, part number D-001810-10).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!