Tissue-culture polyethylene (CPE) and ordinary polyethylene (PE) were provided by NEST Biotechnology Co., Ltd., Wuxi, China. Hydroxyl-terminated poly(N-isopropylacrylamide) (PNIPAAm-OH) was prepared in our lab (Scheme S1a ). Tannic acid (TA, ≥98%), rhodamine B isothiocyanate (BRITC, 99%), 3-aminopropylthiethoxysilane (APTES, 98%), alkaline phosphatase (ALP, 98%), an ALP assay kit, and DMEM were purchased from Sinopharm Chemical Reagent Co., Ltd., Shanghai, China. Mouse fibroblast cells (L929 cells), phosphate buffer saline (PBS, 99.9%, pH = 7.4), and fetal bovine serum (FBS, 97%) were obtained from Guangzhou Oricell Biotechnology Co., Ltd., Guangzhou, China. Calcein acetoxymethyl ester (Calcein AM) and propidium iodide (PI) were obtained from Solarbio, Beijing, China. Carbon dioxide (CO2, 99.999%) was supplied by Guangzhou Spectral Source Gas Co., Ltd., Guangzhou, China.
Tannic acid
Manufactured by Sinopharm
Sourced in China
Tannic acid is a naturally occurring organic compound that is commonly used in various laboratory applications. It is a polyphenolic compound derived from plant sources, primarily from the bark of certain trees. Tannic acid is known for its ability to precipitate proteins, and it has a wide range of potential uses in laboratory settings.
Automatically generated - may contain errors
Lab products found in correlation
Alkaline phosphatase alp, by Sinopharm (1 mentions)
Calcein acetoxymethyl ester calcein am, by Solarbio (1 mentions)
Propidium iodide, by Solarbio (1 mentions)
Rhodamine b isothiocyanate, by Sinopharm (1 mentions)
Ammonia hydroxide, by Sinopharm (1 mentions)
Sodium chloride (nacl), by Sinopharm (1 mentions)
Sodium hydroxide (naoh), by Sinopharm (1 mentions)
Silver nitrate, by Sinopharm (1 mentions)
Acrylamide, by Sinopharm (1 mentions)
Cck 8 kit, by Yeasen (1 mentions)
Dmem medium, by Thermo Fisher Scientific (1 mentions)
Ammonium persulfate, by Sinopharm (1 mentions)
Citric acid, by Sinopharm (1 mentions)
Ferric chloride, by Sinopharm (1 mentions)
Potassium ferricyanide, by Sinopharm (1 mentions)
Polyvinyl alcohol (pva), by Maclin Biochemical Technology (1 mentions)
Sodium citrate, by Maclin Biochemical Technology (1 mentions)
Benzyl alcohol, by Sinopharm (1 mentions)
Chloroauric acid, by Sinopharm (1 mentions)
Sodium borohydride, by Sinopharm (1 mentions)
6 protocols using tannic acid
1
Polyethylene Scaffold Biocompatibility
2
Synthesis and Antimicrobial Assessment of Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Nantokite (CuSO4·5H2O, CuNO3·3H2O, and Cu(CH3COO)2·H2O, purity ≥ 99%), silver nitrate (AgNO3, purity ≥ 99%), PAA (1000 (Average), 35 wt.% in H2O), sodium hydroxide (purity ≥ 99%), tannic acid (purity ≥ 99%), ammonia hydroxide (NH3·H2O, 25–28%), and NaCl (purity ≥ 99%) were all bought from Sinopharm (Shanghai, China) and used as-received. Analytical grade was utilized for all mentioned reagents, and they were all used without further purification. Throughout the study, distilled water was used. The nutrients for bacterial growth were provided from AOBOX Biotechnology (Beijing, China). Three types of bacterial strains (E. coli, P. aeruginosa, and S. aureus) were obtained from China General Microbiological Collection Center (CGMCC).
3
Antimicrobial Hydrogel Synthesis
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Acrylamide, ferric chloride, potassium ferricyanide, citric acid, tannic acid, ammonium persulfate (APS), and 4-sulfanylbutanimidamide (MBA) were purchased from Sinopharm Chemical Reagent Co., Ltd. Solvents and buffer solutions were purchased from Servicebio (China). Lysogeny broth agar plates (LB), Fetal bovine serum, D-MEM medium were purchased from Thermo Fisher Scientific (China). Penicillin–streptomycin solution (PS) was purchased from HyClone (China). CCK-8 kits were purchased from Yeasen Biotech Co., Ltd. (China). NIH-3T3 cells (CL-0171) were purchased from Procell Life Science and Technology Co., Ltd. S. aureus and E. coli were purchased from China Center of Industrial Culture Collection (CICC, Beijing, China). All agents were used as received and used without further purification.
4
Synthesis of Gold-Functionalized CNTs
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
The as-received carbon nanotubes (CNT) were supplied by Shandong Dazhan Nano Materials Company. Chloroauric acid (HAuCl4·3H2O), sodium borohydride, ceria nitrate, tannic acid, benzyl alcohol and other reactants were purchased from Sinopharm Chemical Reagent Company. Polyvinyl alcohol (PVA, Mw = 30 000–70 000), sodium citrate, and p-xylene were provided by Macklin Biochemical Company.
5
Cathepsin B-Responsive Peptide Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
Hydrogen tetrachloroaurate hydrate (HAuCl4·4H2O), sodium citrate, and tannic acid were obtained from Sinopharm Chemical Reagent Co., Ltd., China. Methylthiazoletatrezolium (MTT), 4',6-diamidino-2-phenylindole (DAPI), human recombinant cathepsin B, and GM6001 (a cathepsin B inhibitor) were purchased from Sigma-Aldrich. Cathepsin B-responsive tri-block peptide (CCVGRKKRRQRRRPQVGFLGVEKEKEKEKEK) and non-responsive peptide (CCVGRKKRRQRRRPQVGLGFVEKEKEKEKEK) were purchased from Synpeptides Co., Ltd., Shanghai, China. The micro-bicinchoninic acid (MicroBCA) protein assay kit and 2',7'-dichlorodihydrofluorescein diacetate (DCFH-DA) cellular reactive oxygen species assay kit were purchased from Beyotime Biotechnology Inc., Nantong, China. Dulbecco's modified eagle media (DMEM) was purchased from Gibco, USA. Fetal bovine serum (FBS) was purchased from Sijiqing Co., Ltd., Hangzhou, China. Cell apoptosis detection kit was obtained from BD Biosciences. Other reagents were analytical grade and used as received. Water purified by a Milli-Q system was used in all the experiments.
6
Synthesis of Upconversion Nanoparticles
Check if the same lab product or an alternative is used in the 5 most similar protocols
S-Ethylisothiourea hydrobromide and 1-octadecene (ODE, 90%) were purchased from TCI chemical (Tokyo, Japan). Tetraethyl orthosilicate (98%), Y(CH3COO)3·4H2O (99.9%), Yb(CH3COO)3·4H2O (99.9%), Er(CH3COO)3·XH2O (99.9%) and vinylphosphonic acid were obtained from Sigma Aldrich (St Louis, USA). 3-Mercaptopropyltriethoxysilane was purchased from J&K chemical (Beijing, China). Aminopropyltriethoxysilane (AMEO), allyltriethoxysilane and oleic acid (OA, 90%) were got from Alfa aesar Co. Ltd (Massachusetts, USA). 2,2-Azobis(isobutyronitrile) (AIBN) and Triton X-100 were purchased from GFCO chemical (Hongkong, China). Hydrogen peroxide (30%), ethanol absolute, cyclohexane (95%), methanol (99.5%), tannic acid and ammonia solution (wt 30%) were obtained from Sinopharm chemical reagent Co. Ltd (Shanghai, China). All red grape wines were purchased from their origin (seeing Table S2† for details). All other chemical reagents were of analytical grade and used as received.
+ Expand
S-Ethylisothiourea hydrobromide and 1-octadecene (ODE, 90%) were purchased from TCI chemical (Tokyo, Japan). Tetraethyl orthosilicate (98%), Y(CH3COO)3·4H2O (99.9%), Yb(CH3COO)3·4H2O (99.9%), Er(CH3COO)3·XH2O (99.9%) and vinylphosphonic acid were obtained from Sigma Aldrich (St Louis, USA). 3-Mercaptopropyltriethoxysilane was purchased from J&K chemical (Beijing, China). Aminopropyltriethoxysilane (AMEO), allyltriethoxysilane and oleic acid (OA, 90%) were got from Alfa aesar Co. Ltd (Massachusetts, USA). 2,2-Azobis(isobutyronitrile) (AIBN) and Triton X-100 were purchased from GFCO chemical (Hongkong, China). Hydrogen peroxide (30%), ethanol absolute, cyclohexane (95%), methanol (99.5%), tannic acid and ammonia solution (wt 30%) were obtained from Sinopharm chemical reagent Co. Ltd (Shanghai, China). All red grape wines were purchased from their origin (seeing Table S2
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!