The largest database of trusted experimental protocols

8 protocols using invivomab anti mouse pd 1

1

Dendritic Cell Activation Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols
PRT, OVA, propidium iodide (PI) and lipopolysaccharides (LPS) were purchased from Sigma-Aldrich (St. Louis, MO, USA). CpG 1826 (5′-TCC ATG ACG TTC CTG ACG TT-3′) was bought from Sangon (Shanghai, China). Granulocyte-macrophage colony stimulating factor (GM-CSF) and interleukin-4 (IL-4) from mouse were bought from Novus Biologicals (Colorado, USA). The antibodies such as CD11c-PE, CD86-APC, CD80-FITC, CD3e-PE, CD8a-FITC and OVA257-264 (SIINFEKL) peptide bound to H-2 Kb APC for flow cytometry (FCM) detection, and the biotinylated OVA257-264 (SIINFEKL) peptide bound to H-2 Kb monoclonal antibody for immunofluorescence, these antibodies were all bought from eBioscience (CA, USA). The ELISA kits for mouse interleukin-6 (IL-6), tumor necrosis factor-α (TNF-α) and interferon-γ (IFN-γ) were bought from R&D Systems (Minneapolis, MA, USA). The aPD-1 (InVivoMab anti-mouse PD-1) was purchased from BioXcell (New Hampshire, USA). Avidin-FITC was bought from Boster Bio-Tech (Wuhan, China).
+ Open protocol
+ Expand
2

T cell depletion and anti-PD-1 immunotherapy

Check if the same lab product or an alternative is used in the 5 most similar protocols
CD4+ T lymphocytes and CD8+ T lymphocytes were depleted by intraperitoneal injection of 200 µg neutralising antibody (InVivoMab anti‐mouse CD8α, Bio X Cell, Clone: 2.43; or InVivoMab anti‐mouse CD4, Bio X Cell, Clone: GK1.5) on the day of cryoablation and every 3 days from the second day after cryoablation. The depletion efficacy was verified by flow cytometry. Anti‐mouse PD‐1 (200 µg/dose, InVivoMab anti‐mouse PD‐1, Bio X Cell, Clone: J43) was injected into rechallenged mice after cryoablation or surgical resection of primary tumours every 3 days for a total of five times.
+ Open protocol
+ Expand
3

Tumor Growth Monitoring in BALB/c Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols
Female BALB/c mice (8-week-old) were inoculated with 1 × 106 4T1-Luc cells in 100 μl of PBS by subcutaneous injection into the upper right mammary fat pad. Tumors were measured with calipers, and tumor volume was calculated according to the formula (1/2 × length × width2). The tumor-bearing mice were randomly allocated to the control and treatment groups on day 6 after implantation. For the cell treatment groups, the mice received intravenous injected 1 × 106 engineered macrophages in 100 μl of PBS per mouse per injection every 3 days for 12 days. The day after cell injection, the mice in antibody treatment groups received intraperitoneal injected 50 μg of aPD-1 (InVivoMab anti-mouse PD-1, Bio X Cell) per mouse per injection. Engineering BMDMs were acquired from BALB/c mice as previously described, and M1-polarized macrophages were engineered by incubating with ARMFUL for 4 hours in serum-free DMEM. To monitor tumor growth, the mice received in vivo imaging on days 2, 7, and 12 after the first injection. Briefly, mice were administrated with 200 μl of d-luciferin potassium salt bioluminescence substrate (15 mg/ml; Yeasen) in PBS and 200 μl of pentobarbital sodium (0.6 wt %) in PBS via intraperitoneal injection. Ten minutes after injection, mice were imaged under anesthesia using an in vivo imaging system (AniView600, BLT Photon Technology).
+ Open protocol
+ Expand
4

Cardiac Troponin I Peptide Synthesis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Crocin was a gift from Reyoung Pharmaceutical Co., Ltd. (Shanghai, China). InVivoMab Anti-mouse PD-1 was purchased from Bioxcell Co., Ltd. (West Lebanon, USA). Murine cardiac troponin I (TnI) peptide HARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRIS was synthesized by Sangon Biotech Co., Ltd. (Shanghai, China) according to the literature before.28 (link)
+ Open protocol
+ Expand
5

Murine Tumor Immunotherapy Model

Check if the same lab product or an alternative is used in the 5 most similar protocols
B16-WT or CRISPR-modified cells (5 × 105) were injected subcutaneously in bilateral flanks of C57BL/6 mice (6 to 10 weeks of age) on day 0. When tumors reached a volume of at least 50 mm3, mice were randomized into different treatment groups according to the experimental plan. InVivoMab anti-mouse PD-1 (reference no. BE0146) and anti-mouse CTLA-4 (reference no. BE0131) or their corresponding isotypes, anti-trinitrophenol [rat immunoglobulin G2a (IgG2a), reference no. BE0089] and polyclonal Syrian hamster IgG (reference no. BE0087) from Bio X Cell, were administered by intraperitoneal injection (200 μg per antibody per dose). Focal tumor–directed computed tomography–guided radiation was delivered using the Small Animal Radiation Therapy platform (Precision X-Ray) with mice anesthetized using isoflurane. Tumors were measured daily until the animals died or the tumor volume reached 2000 mm3.
+ Open protocol
+ Expand
6

T-cell Activation Assay with PD-1 Blockade

Check if the same lab product or an alternative is used in the 5 most similar protocols
The anti-human PD-1 antibody (used at a 10 μg/mL concentration) was obtained from Merck & Co., Inc. (New Jersey, USA). In VivoM Ab anti-mouse PD-1 (used at a 10 μg/mL concentration) and In VivoM Ab anti-mouse IgG2a were purchased from Bioxcell (New Hampshire, USA). STAT3 inhibitor Stattic (used at a 5 μM concentration) was purchased from MedChemExpress (New Jersey, USA). Stattic was dissolved in DMSO. Recombinant human IL-2 (used at a 200 IU/mL concentration) was obtained from Thermo Fisher Scientific (Waltham, USA) and solubilized in PBS with 1% BSA. Ultra-LEAF™ Purified anti-human CD3 antibody (used at 1 µg/mL concentration, clone: OKT3), Ultra-LEAF™ Purified anti-human CD28 antibody (1 µg/mL concentration, clone: 28.2), and cell activation cocktail (with Brefeldin A) were purchased from Biolegend (San Diego, USA). Fixable viability Dye eFluor™ 780 was obtained from Thermo Fisher Scientific (Waltham, USA) and solubilized in DMSO.
+ Open protocol
+ Expand
7

Investigating FGFR1 in Murine NSCLC

Check if the same lab product or an alternative is used in the 5 most similar protocols
The mouse NSCLC cell line LLC was obtained from our laboratory. Hygromycin B (1 μg/ml) was added to shFGFR1 and the control shRNA. Healthy male C57BL/6 mice aged 6-8 w were inoculated with FGFR1 knockdown or wild-type LLC cells. The cells (50*10^4) were digested, washed, and resuspended in 100 μL PBS before being injected into the left armpit of each mouse. Beginning on day 6, the size of each tumor was measured with calipers every three days. The subcutaneous tumor volume was calculated as (L2×W)/2, where V is the tumor volume, L is the longest diameter, and W is the shortest diameter. InVivoMab anti-mouse PD-1 (Bio X Cell, USA) or rat IgG2α isotype (Bio X Cell, USA) was injected intraperitoneally at a dose of 100 μg per mouse on day 6, 8, 10 and 12. The mice were sacrificed on day 15. The tumors were removed and then imaged and analyzed. The tissues were digested with collagenase A (0.33 U/ml), dispase (0.85 U/ml) and DNase I (144 U/ml) with rapid shaking at 37 °C. Large pieces of debris were removed by successive filtration through 70-µm and 40-µm strainers.
+ Open protocol
+ Expand
8

Investigating FGFR1 in Murine NSCLC

Check if the same lab product or an alternative is used in the 5 most similar protocols
The mouse NSCLC cell line LLC was obtained from our laboratory. Hygromycin B (1 μg/ml) was added to shFGFR1 and the control shRNA. Healthy male C57BL/6 mice aged 6-8 w were inoculated with FGFR1 knockdown or wild-type LLC cells. The cells (50*10^4) were digested, washed, and resuspended in 100 μL PBS before being injected into the left armpit of each mouse. Beginning on day 6, the size of each tumor was measured with calipers every three days. The subcutaneous tumor volume was calculated as (L2×W)/2, where V is the tumor volume, L is the longest diameter, and W is the shortest diameter. InVivoMab anti-mouse PD-1 (Bio X Cell, USA) or rat IgG2α isotype (Bio X Cell, USA) was injected intraperitoneally at a dose of 100 μg per mouse on day 6, 8, 10 and 12. The mice were sacrificed on day 15. The tumors were removed and then imaged and analyzed. The tissues were digested with collagenase A (0.33 U/ml), dispase (0.85 U/ml) and DNase I (144 U/ml) with rapid shaking at 37 °C. Large pieces of debris were removed by successive filtration through 70-µm and 40-µm strainers.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!